KEGG   Haloarcula marismortui: rrnAC1762Help
Entry
rrnAC1762         CDS       T00211                                 

Gene name
serA2
Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
hma  Haloarcula marismortui
Pathway
hma00260  Glycine, serine and threonine metabolism
hma00680  Methane metabolism
hma01100  Metabolic pathways
hma01120  Microbial metabolism in diverse environments
hma01130  Biosynthesis of antibiotics
hma01200  Carbon metabolism
hma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hma00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    rrnAC1762 (serA2)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    rrnAC1762 (serA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hma04147]
    rrnAC1762 (serA2)
Enzymes [BR:hma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     rrnAC1762 (serA2)
    1.1.1.399  2-oxoglutarate reductase
     rrnAC1762 (serA2)
Exosome [BR:hma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   rrnAC1762 (serA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh
Motif
Other DBs
NCBI-ProteinID: AAV46660
UniProt: Q5V1E2
Position
I:1572105..1573076
Genome map
AA seq 323 aa AA seqDB search
MSYKVVVSDTKVMHGETRAAVLDAVDATVETIAAKEPEAVARAVDGADALIVDAGTQVTA
EVIEAADSLKVVGRAGIGMDNIAVRAAVAAGVTVVNVPDYSVEEVSTHTFALMLACLRRI
PTFDRSVKRGEWKWAVGQPIRRLAGSTVGLVAFGKLASRFAAKLRGFDIDVIAYDPYAPE
YRMGDLGVESVTLETLLGDSDIVSLHAPLTDETRGMIDADALDRMHDDALLVNTARGGLV
DETALYDALISGDLGGAGLDVRKPEPPGDSPLHDLDSVVCSPHVAWYSEESRVELTQTVA
EDVIRVLRGEQPENPIDPETGWF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtcatacaaagtcgtcgtctctgacaccaaagtgatgcacggggagacacgggcggcg
gtgttggatgcggttgatgcgaccgtcgaaacgatagcggcgaaagagccggaggccgtc
gcacgcgcagtagacggtgcggacgcattgatcgtcgacgccggcacgcaggtcacagcc
gaggtcatcgaggccgccgactcgctcaaagtggtgggccgggccggcatcggcatggac
aacatcgccgttcgggcggcggttgcggccggcgtaacggtcgtcaacgttccggactac
tctgtcgaggaggtgtcgacccacacgttcgcactcatgctcgcttgcctgcggaggata
cccacgttcgaccgctcggtcaagcgtggcgagtggaagtgggctgtcggacagccgatc
cgtcgcctcgccggcagcaccgtcggcctcgtcgccttcggcaagctcgccagccggttc
gccgcgaagcttcgtgggttcgatatcgatgttatcgcctacgacccgtacgcgcccgag
taccggatgggtgacctcggcgtcgaatcggtcacgctcgagacgctgctgggcgattcc
gatatcgtctcgctgcacgctccgctgaccgacgagacgcgcgggatgatcgacgccgac
gcgcttgaccgaatgcacgacgacgcactgctcgtgaacacggccagaggcgggcttgtc
gacgaaacggcgctgtacgacgcgctcatcagcggcgatctcggcggggccgggctggac
gtgcgcaagccagagccgccgggagactcaccgctacacgacctcgacagcgttgtctgt
agtccccacgtcgcgtggtattccgaggagtcccgggtcgagctgacacagaccgtggcc
gaagatgtcatccgggtactgcggggcgagcagcccgagaatcccatcgaccccgagacc
ggctggttctga

DBGET integrated database retrieval system