KEGG   Haloarcula marismortui: rrnAC1885Help
Entry
rrnAC1885         CDS       T00211                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hma  Haloarcula marismortui
Pathway
hma00260  Glycine, serine and threonine metabolism
hma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hma01100  Metabolic pathways
hma01110  Biosynthesis of secondary metabolites
hma01130  Biosynthesis of antibiotics
hma01230  Biosynthesis of amino acids
Module
hma_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    rrnAC1885 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    rrnAC1885 (trpB)
Enzymes [BR:hma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     rrnAC1885 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AAV46764
UniProt: Q5V139
Position
I:complement(1682527..1683789)
Genome map
AA seq 420 aa AA seqDB search
MSTDDAYDPKFGEYGGQYVPEALMPAIEELTDAYQRYVLENEDGFMDEFRERLADFGGRP
TPLQYADQLSARYDTDVYLKREDLLHGGAHKLNNALGQVLLAKYMGKERIIAETGAGQHG
TATAMAAAHLDMPCEIYMGESDIARQRPNVFRMRINGSEVNPVTVGRGTLKEAISETMRD
WATTVENTHYVIGSIVGPHPFPKMVRDFHAVISEEARKQIRETTGGLPDSVMACAGGGSN
TMGMFAEFIDDPEVDLFAVEAGGSSLQVDEEKGVAPNSATLSTGDEGVLHGARTKLLQDS
DGQIMESHSVSSGLDYAGVGPELAHLVDEERVTPVNVDDDVALEAFHRLSQDEGIIPALE
TAHAFGYLEEHHDEVGDSVIINVSGRGDKDLEIAIEETAKRDLDIAPDMSIFERVGGGGL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgacgacgcatacgaccccaagttcggcgagtacggtggacagtacgtgccc
gaggcgctgatgccagctatcgaagagctgaccgacgcctaccagcggtacgtgctcgaa
aacgaggacggcttcatggacgaattccgggaacggctggccgacttcggtggccgaccg
acgccgctgcagtacgcggaccagctctcggcccggtacgacacggacgtctacctcaag
cgcgaggacctgcttcacggcggcgcacacaagctcaacaacgcgctcggacaggtcttg
ctggcgaagtacatgggcaaggagcggattatcgccgagaccggcgcgggccagcacggc
acggcgacggcgatggcggcggcccacctcgatatgccctgtgagatctacatgggcgag
agcgatatcgcacgccagcgccccaacgtgttccggatgcgcatcaacggctccgaggtt
aatcccgtcacggtcggccgcggcacgctgaaggaagccatctccgagacgatgcgggac
tgggcgaccaccgtcgagaacacccactacgtcatcgggagtatcgtcggtccgcacccg
ttcccgaagatggtgcgtgacttccacgcggtcatttccgaagaagcccgcaaacagata
cgtgagacgaccggtggcctgcccgattccgtgatggcctgtgctggcggcgggtcgaac
actatggggatgttcgccgagtttatcgacgaccccgaagtcgacctcttcgctgtcgag
gccggcggctcctcgctgcaggtcgacgaggagaagggcgtcgcaccgaactccgcgaca
ctttcaactggcgacgaaggcgtgctccatggcgcgcgcacgaagctcctgcaggattcg
gacggccagatcatggaatcccactccgtttcgtcggggctggactacgccggtgtcggc
ccggaactcgcccaccttgtcgatgaggagcgcgtcacaccggtcaacgtcgacgacgac
gtcgcgctggaggcgttccaccgcctctcacaggacgagggtatcatcccggccctagag
acagcccacgccttcggttacctcgaagagcaccacgacgaagtcggtgactctgtcatc
atcaacgtctccggccgcggcgacaaggacctcgaaatcgccatcgaggagaccgcgaaa
cgtgacctcgatatcgccccggacatgtctatcttcgagcgcgtcggcgggggtggcctc
tga

DBGET integrated database retrieval system