KEGG   Haloarcula marismortui: rrnAC1913Help
Entry
rrnAC1913         CDS       T00211                                 

Gene name
nadM
Definition
(GenBank) nicotinamide-nucleotide adenylyltransferase
  KO
K00952  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
hma  Haloarcula marismortui
Pathway
hma00760  Nicotinate and nicotinamide metabolism
hma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    rrnAC1913 (nadM)
Enzymes [BR:hma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     rrnAC1913 (nadM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID: AAV46786
UniProt: Q5V117
Position
I:complement(1707190..1707756)
Genome map
AA seq 188 aa AA seqDB search
MRGFYIGRFQPYHNGHHSMVERISEEVDELVLGIGSADDSHTTHDPFTAGERIMMITKAV
AEYDLTTYVVPLEDINRNAVWVSHVESMCPDFDVAYSNNPLVVRLFEEAGIEVRQSPMFD
RDRLEGSEIRQRMIDDESWRDRVPASVVEVIEEIHGIKRLQHVSDSDSLERYAATGESLP
ESLDDLDD
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgggttctacatcggtcgcttccagccctaccacaatggccatcactcgatggtc
gagcggatctcggaggaggtcgacgagcttgtactgggtatcgggagcgccgacgattca
cacaccacacacgacccctttacggccggtgaacggatcatgatgatcacgaaggccgtc
gcagagtacgacctgacgacttatgtcgttccccttgaggacatcaaccgcaacgccgtc
tgggtgagccacgtcgagagtatgtgcccggacttcgacgtggcgtactcgaacaatccg
cttgtcgtccgcttgttcgaggaggccggtatcgaggtccgccagtcgccgatgttcgac
cgcgaccgactggagggcagcgagatccgccagcggatgatcgacgacgagtcctggcgt
gaccgggtcccggcatctgttgtggaagtcatcgaggagatccacggcatcaagcgactc
cagcacgtctcagacagcgactcgctcgaacggtacgccgccacgggcgaatcgctcccc
gaatcactcgacgaccttgacgactga

DBGET integrated database retrieval system