KEGG   Haloarcula marismortui: rrnAC2262Help
Entry
rrnAC2262         CDS       T00211                                 

Gene name
gapB
Definition
(GenBank) glyceraldehyde 3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
hma  Haloarcula marismortui
Pathway
hma00010  Glycolysis / Gluconeogenesis
hma01100  Metabolic pathways
hma01110  Biosynthesis of secondary metabolites
hma01120  Microbial metabolism in diverse environments
hma01130  Biosynthesis of antibiotics
hma01200  Carbon metabolism
hma01230  Biosynthesis of amino acids
Module
hma_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    rrnAC2262 (gapB)
Enzymes [BR:hma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     rrnAC2262 (gapB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AAV47092
UniProt: Q5V061
Position
I:2012779..2013843
Genome map
AA seq 354 aa AA seqDB search
MLHVGINGFGTIGKRVADAVRVQPDMTVAGVAKRSPNFEATIADDRGYDLYAADGREPFD
EADLGTAGTVHDLIETSDVVVDTTPSGVGAANASLYAEHDTPAIFQGGEDADVADVSFNA
RANYEKAVGADTARVVSCNTTGLSRLLAPLRESYGVEKSRVTLVRRGADPGQTGRGPIND
TLPDPVEIPSHHGPDVQTIFPDLDIDTMGMKVPTTQMHTHSVNVTLESEPATEEVTALLA
DESRLFLIPETLGIDGAGKLKEYTRDAGRPRGDVWENCIWAESITVEGRDLYLFQAIHQE
ADVVPENIDAVRALSERTASAEKSIRRTDEALGVGRGLVEHDGSPQRVDSHADD
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgctccacgtgggcatcaacggcttcggcaccatcgggaaacgcgtcgctgacgcggtg
cgtgtccagccagatatgacagttgcgggcgtcgcaaagcgctcgccgaacttcgaggca
actatcgcggacgaccgcggctatgatctctacgccgcggacggccgcgaaccgttcgat
gaagccgatctcggtacggccggtacggtccatgaccttatcgagacgagcgacgtggtc
gtcgacaccacgccaagtggcgtcggcgcggccaacgcgtcgctatacgccgaacatgac
acgccggccatcttccagggtggagaggacgccgatgtggcagacgtgagcttcaacgct
cgcgccaactacgagaaggcagtcggggctgatacggcccgcgtcgtgtcatgcaataca
acgggcctttcacgcctgctcgcaccgcttagggaatcatacggcgttgaaaaatcgcgt
gtgacactggtacggcgcggtgccgacccgggccagaccggtcgtggcccgatcaacgac
acactccccgaccccgtcgaaatcccctcccaccacggtcccgacgtccagacgattttt
cccgaccttgacatcgatacgatgggcatgaaggtcccgacgacgcagatgcacacccac
agcgtcaacgtcacgctggaaagcgaacccgccacagaggaggtcacggcgctgctcgcc
gacgaatcgcggctgttcctcatcccggagacgctcggtatcgacggcgcagggaaactc
aaagagtacacccgtgacgccggtcgcccgcgtggtgacgtgtgggagaactgtatctgg
gccgaatccatcacagttgaggggcgggacctctatctgttccaggcgattcaccaggaa
gccgatgtcgtgccggagaacatcgacgccgttcgcgcgctctcagagcggaccgcaagc
gctgaaaagagcatccgccggaccgacgaagccctcggtgtcgggcgcggcctcgtcgaa
cacgacgggagcccgcaacgcgtcgacagtcacgccgacgactga

DBGET integrated database retrieval system