KEGG   Haloarcula marismortui: rrnAC2305Help
Entry
rrnAC2305         CDS       T00211                                 

Definition
(GenBank) unknown
  KO
K19243  NAD+ dependent glucose-6-phosphate dehydrogenase [EC:1.1.1.388]
Organism
hma  Haloarcula marismortui
Pathway
hma00030  Pentose phosphate pathway
hma01100  Metabolic pathways
hma01110  Biosynthesis of secondary metabolites
hma01120  Microbial metabolism in diverse environments
hma01130  Biosynthesis of antibiotics
hma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    rrnAC2305
Enzymes [BR:hma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.388  glucose-6-phosphate dehydrogenase (NAD+)
     rrnAC2305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_4 Polysacc_synt_2 GDP_Man_Dehyd NAD_binding_10 RmlD_sub_bind NmrA
Motif
Other DBs
NCBI-ProteinID: AAV47129
UniProt: Q5V024
Position
I:complement(2052639..2053412)
Genome map
AA seq 257 aa AA seqDB search
MDDPVLLTGAGGAVGAAILEGLEDAYEWKLMFHSPPAEEPDHEYLVGDVSSEGDVAAAMD
GVGAVIHLAGDPRPEAPWDSVLENNIDGTQKMYEAAVDEGVEKFVFASSNHAVGSFETDE
RTPEMYRPDDQYRLDGTELPRPGNLYGVSKATGEVLGRYYHDEHGLSVCNIRIGNLTRGH
PPIDYERGQAMWLSYRDCAHIHDCALQADYEYEIVYGISDNDRKYYSIERAKDVLGYDPQ
DNSAHFDGEERVAEPEP
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggacgacccggttctgctcaccggcgctggcggcgctgtcggggcggccatcctcgaa
ggactcgaggacgcctacgagtggaaactcatgttccacagcccacccgccgaggagccc
gaccacgagtacctcgtcggggacgtgtccagcgagggcgacgtggccgcggcgatggac
ggcgtcggcgctgtcatccatctggccggcgacccccggccggaagccccctgggactcc
gtcctcgaaaacaacatcgacggcacccagaagatgtacgaggccgctgtcgacgagggc
gtcgagaagttcgtcttcgcgtcctcgaaccacgccgtcggctccttcgaaacggacgag
cgcacgcccgagatgtatcgcccggacgaccagtaccgccttgacgggaccgagctcccc
cgccccggcaacctctacggcgtctcgaaagccaccggcgaggtgctgggccgctactac
cacgacgagcacggcctctccgtctgtaacatccgtatcggcaacctcacgcggggccac
ccgccgatagactacgagcgcgggcaggcgatgtggctctcttaccgggactgcgcccac
atccacgactgcgcgctgcaggccgactacgagtatgaaatcgtctacggcatctccgac
aacgaccgcaagtactactccatcgagcgcgccaaggacgtgcttgggtacgacccacag
gacaactccgcgcactttgacggcgaagaacgcgtcgccgaaccggaaccgtag

DBGET integrated database retrieval system