KEGG   Haloarcula marismortui: rrnAC3113Help
Entry
rrnAC3113         CDS       T00211                                 

Gene name
rpl31E
Definition
(GenBank) 50S ribosomal protein L31e
  KO
K02910  large subunit ribosomal protein L31e
Organism
hma  Haloarcula marismortui
Pathway
hma03010  Ribosome
Module
hma_M00179  Ribosome, archaea
Brite
KEGG Orthology (KO) [BR:hma00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    rrnAC3113 (rpl31E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hma03011]
    rrnAC3113 (rpl31E)
Ribosome [BR:hma03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    rrnAC3113 (rpl31E)
  Archaea
    rrnAC3113 (rpl31E)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L31e Tom37_C
Motif
Other DBs
NCBI-ProteinID: AAV47824
UniProt: P18138
Structure
PDB: 

Position
I:2754737..2755015
Genome map
AA seq 92 aa AA seqDB search
MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAW
ARGRANTPSKIRVRAARFEEEGEAIVEAETAE
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccagtgacttcgaggagcgtgtcgtcaccatcccgctccgagacgcgcgagct
gaaccgaaccacaagcgcgcagacaaggcgatgatcctcatccgcgagcacctcgccaaa
cacttctctgtcgacgaggacgccgtccgcctcgacccctcgatcaacgaggcggcctgg
gcccgcggtcgcgccaacacgccgagcaagatccgtgttcgcgccgcccgcttcgaggaa
gagggcgaagccatcgtcgaagcagagaccgcagagtaa

DBGET integrated database retrieval system