KEGG   Haloarcula marismortui: rrnB0290Help
Entry
rrnB0290          CDS       T00211                                 

Gene name
phoT1
Definition
(GenBank) sodium-dependent phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hma  Haloarcula marismortui
Brite
KEGG Orthology (KO) [BR:hma00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    rrnB0290 (phoT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AAV48458
UniProt: Q5UW95
Position
II:241797..242978
Genome map
AA seq 393 aa AA seqDB search
MELQLLALFLTAGLASLFMSWVIGAGSSGATPFAPAVGANAISTMRAAFIVGIFGLAGAV
TQGSNVSEAVGRGLIGGVTLPATGVIVALLAGAGLMAVGIYTGYPIATAFTVTGAIIGVG
LALGGTPVWGKYQQIGAVWVLTPVVGGGFAYAIASVLPRSDAPEKATIPTLAALVGVVLA
NVEFAFLGSGGGPGSLTSLGQRLLGIDGVVATVVLSGTVAAVVWAAVYRDIRHDEAGGLR
HVLLALGSLVAFSAGGSQVGLAVGPLLPLLDEVGALSPAVVLLGGGLGILVGSWTGAPRM
IKSLAQDYSSLGPRRSIAALVPSFLIAQLAVFLGVPVSFNEIIVSAIIGSGAAVGGSEAI
DPQKIVVTVGAWAGSFTLALAVGFGSMTAMGAL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaactccagcttctcgcgctcttcttgaccgccggtctcgcgagcctgttcatgtcg
tgggttatcggtgctggctctagcggcgcgacgccgttcgcgcccgctgtcggtgccaac
gccatttcgacgatgcgggcggcgttcatcgtcggcatctttggtctcgcgggcgcggtg
acacaggggtcgaacgtctcggaagcggtcggccgcggcctcatcggcggcgtcaccctt
cccgccactggggtcatcgtcgcgctgctggccggcgctgggctcatggccgtcggtatc
tacaccggttaccccatcgcgacggcgtttactgtgaccggcgcaatcatcggtgtcggg
ctggccctcggtggcacccccgtctgggggaagtaccagcaaatcggtgccgtctgggtc
ctgacaccggtcgtcggcggcggtttcgcctacgccatcgcgagcgtgctgccgcggtct
gatgcccccgaaaaggccaccattccgacgctcgcggcgctggtcggcgtcgtgctggcc
aacgtcgagttcgcgtttctcgggtccggcggcggccccggttcgctgacgagcctcggc
cagcgactgctcggcatcgacggcgtcgtggcgacagtcgttctctccggcactgtcgcc
gccgtggtgtgggccgcggtgtaccgagacatccgccacgacgaggcgggcggactcaga
cacgtcctgctagcgctcggttctctggtcgccttttcagccggtgggagtcaggtcggg
ctggcggtcggtccgttgctcccattgctggacgaggttggggcgctctcgccagcggtc
gtcctgctggggggtggcctcggaattctggtcgggtcgtggaccggcgcgccacggatg
ataaaatcgctcgcacaggactattcttcgctgggcccgcggcgctctatcgccgcgctc
gtcccctcgttcctcatcgcgcaactcgccgtcttcctcggtgtgccggtgtcgttcaac
gagattattgtcagcgctatcatcgggagcggtgccgcagtcggcggcagcgaggcgatc
gacccacagaagattgtggtcacagttggcgcgtgggccgggtcgttcacgcttgcgctg
gccgttggcttcgggtcaatgaccgcgatgggcgcgctctga

DBGET integrated database retrieval system