KEGG   Hyphomicrobium sp. MC1: HYPMC_0256Help
Entry
HYPMC_0256        CDS       T01557                                 

Definition
(GenBank) putative aldehyde dehydrogenase SE_1720
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
hmc00010  Glycolysis / Gluconeogenesis
hmc00053  Ascorbate and aldarate metabolism
hmc00071  Fatty acid degradation
hmc00280  Valine, leucine and isoleucine degradation
hmc00310  Lysine degradation
hmc00330  Arginine and proline metabolism
hmc00340  Histidine metabolism
hmc00380  Tryptophan metabolism
hmc00410  beta-Alanine metabolism
hmc00561  Glycerolipid metabolism
hmc00620  Pyruvate metabolism
hmc00625  Chloroalkane and chloroalkene degradation
hmc00903  Limonene and pinene degradation
hmc01100  Metabolic pathways
hmc01110  Biosynthesis of secondary metabolites
hmc01120  Microbial metabolism in diverse environments
hmc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HYPMC_0256
   00053 Ascorbate and aldarate metabolism
    HYPMC_0256
   00620 Pyruvate metabolism
    HYPMC_0256
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HYPMC_0256
   00561 Glycerolipid metabolism
    HYPMC_0256
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HYPMC_0256
   00310 Lysine degradation
    HYPMC_0256
   00330 Arginine and proline metabolism
    HYPMC_0256
   00340 Histidine metabolism
    HYPMC_0256
   00380 Tryptophan metabolism
    HYPMC_0256
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HYPMC_0256
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HYPMC_0256
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HYPMC_0256
Enzymes [BR:hmc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     HYPMC_0256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CCB63490
UniProt: F8J7L7
Position
complement(253439..254857)
Genome map
AA seq 472 aa AA seqDB search
MIDCSRFYIDGQWIKPATRSFMDLINPATTEKFGRVVLGCQQDVDAAVAAAKRALAAYET
SSRELRLTYFDKIISAYEARKKDLAEAITLEIGSPISFSMNVQVEMALNHFLATREVLKS
YPFEFKIANDVVRREPFGVVGLITAWNWPVALIASKVCGALAAGCTIVLKPSEYSPVAAR
IFAEIIDAARLPPGVFNMIYGDGPTVGRSIATHPDIALVSFTGSVQTGIAIARDAAETVK
AVHQELGGKSANIILPDADLKTAIPDAVRRAFINCGQSCIAPTRLLIHADQVERAAEIAK
RTAEAFKIGDPFDPTTTLGPLANRAQFLKVNSMIGAGLAEGARLVCGGPGFSSGIDRGYF
VQPTIFKNVTPKMKIAAEEIFGPVLSILSYHDEEDAIQIANNTSFGLAGYVFSSSVENAK
RVGEKLKAGRIFVNGAPSNATAPFGGYKQSGNGREAGVFGLEAFLEVKAIIG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgatcgactgctctcgcttctatatagatggtcaatggatcaagccggcgacccgcagc
ttcatggatttgatcaatcccgcgacgacggaaaaattcggacgcgtcgtactcggttgc
cagcaggacgtggatgcggctgtggcggcggcaaaacgcgcgttggccgcttatgagaca
tcatcacgagaactacgcctcacctatttcgacaagattatctcggcatacgaagcgcgc
aaaaaggatctcgcagaagcgattacgctcgagataggatcacccatttcattctcgatg
aacgtgcaggtcgaaatggctctcaaccatttcctcgcgactcgcgaagttctcaaatca
tatccttttgaattcaagatcgccaatgacgtggttcgtagagagccgttcggcgtcgtg
ggtctgataaccgcctggaattggcctgtcgcactgatcgcatcgaaagtttgcggggcg
ttggcggccgggtgcacgatcgtattaaagccaagcgaatattcgcccgttgcagcgcgc
atatttgctgagatcatcgatgcggccagactgccgcctggcgtcttcaatatgatctat
ggcgatggcccgacagttggccgctccatcgcaacacatcccgacatcgccctcgtttcg
tttaccggatctgtccaaactggtatcgcgattgcgcgagatgcagcggagaccgttaag
gcagtacaccaggagctcggcggaaaatccgcaaatatcatactgcccgatgccgactta
aaaactgcgattccggatgcggtcagacgggctttcattaattgcggccaaagctgcatc
gcgcccacccggctcctaatccatgctgaccaagtcgaacgcgccgcggagattgcgaag
agaaccgcggaggcgttcaaaatcggagatccttttgatccgaccaccacgcttggaccc
cttgcaaatcgtgcccaatttctgaaggtcaactcgatgatcggagccggactcgcagaa
ggggcgaggctcgtctgcgggggaccaggattcagcagcggaatagacagaggctatttc
gtgcagccgaccatcttcaagaatgtaacgccgaagatgaaaatcgccgccgaagaaatc
ttcggacctgtgctaagcatcctgtcctatcacgatgaagaagatgcgatccaaattgcg
aacaatacgtctttcggacttgccggatatgtcttttctagcagtgttgagaatgccaag
cgcgtcggagaaaaactcaaagccggccgtatttttgtgaacggcgcgccgagcaacgcg
actgcaccttttggaggctacaaacaatcaggcaatggacgagaagcgggtgttttcggt
ctggaagcatttttggaagtgaaggccatcatcggttga

DBGET integrated database retrieval system