KEGG   Hyphomicrobium sp. MC1: HYPMC_0267Help
Entry
HYPMC_0267        CDS       T01557                                 

Gene name
ubiX
Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (Polyprenyl p-hydroxybenzoate decarboxylase)
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
hmc00130  Ubiquinone and other terpenoid-quinone biosynthesis
hmc00627  Aminobenzoate degradation
hmc01100  Metabolic pathways
hmc01110  Biosynthesis of secondary metabolites
hmc01120  Microbial metabolism in diverse environments
hmc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hmc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    HYPMC_0267 (ubiX)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    HYPMC_0267 (ubiX)
Enzymes [BR:hmc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     HYPMC_0267 (ubiX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: CCB63501
UniProt: F8J7M8
Position
264128..264706
Genome map
AA seq 192 aa AA seqDB search
MSKKKLIVGISGASGAIYGVRLLDALGALGIETHLVMSKSAKMTLASETDLKVSDVNAKA
SVVYQIDDVGAAIASGSFITAGMIVAPCSIRTLSEIAWGTTSNLLTRAADVTLKDRRRLV
LMVRETPLHLGHIRSMAQATEAGAIIAPPVPAFYARPQSIDDMIDHSIGRMLDLFEIENH
LALRWPEPGEDR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaaaaagcttatcgtagggatcagtggcgcgtcaggtgccatctacggggtc
cgtctactcgatgcgttgggcgctcttggaatcgagacgcatctggtgatgtccaagtcg
gctaagatgaccttggcttccgaaaccgatcttaaggtttcggatgttaatgcaaaggcg
agcgttgtctaccagatcgacgacgtcggtgcggcgattgccagcggctctttcatcacc
gccggaatgatcgtggcgccatgctcgatccggacgttgagcgagatcgcgtgggggacc
acgtcgaatttgctgacccgagctgccgacgtcacgcttaaagacaggcggcgcttggtc
ttaatggtgcgcgaaacgccgctgcatctcgggcatattcgatcaatggcacaggcgaca
gaggccggagctattatcgcgccgccggttccggccttctacgccaggccgcaatctatc
gatgacatgattgatcattcgattgggcgcatgctcgatttattcgagatcgaaaatcat
cttgcactgcgctggcctgaaccgggagaggacagatag

DBGET integrated database retrieval system