KEGG   Hyphomicrobium sp. MC1: HYPMC_1595Help
Entry
HYPMC_1595        CDS       T01557                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
hmc00010  Glycolysis / Gluconeogenesis
hmc00051  Fructose and mannose metabolism
hmc00562  Inositol phosphate metabolism
hmc00710  Carbon fixation in photosynthetic organisms
hmc01100  Metabolic pathways
hmc01110  Biosynthesis of secondary metabolites
hmc01120  Microbial metabolism in diverse environments
hmc01130  Biosynthesis of antibiotics
hmc01200  Carbon metabolism
hmc01230  Biosynthesis of amino acids
Module
hmc_M00002  Glycolysis, core module involving three-carbon compounds
hmc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HYPMC_1595 (tpiA)
   00051 Fructose and mannose metabolism
    HYPMC_1595 (tpiA)
   00562 Inositol phosphate metabolism
    HYPMC_1595 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    HYPMC_1595 (tpiA)
Enzymes [BR:hmc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HYPMC_1595 (tpiA)
Exosome [BR:hmc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HYPMC_1595 (tpiA)
  Exosomal proteins of bladder cancer cells
   HYPMC_1595 (tpiA)
  Exosomal proteins of melanoma cells
   HYPMC_1595 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CCB64825
UniProt: F8J8R0
Position
1513044..1513820
Genome map
AA seq 258 aa AA seqDB search
MGKTGRGIRPLVAGNWKMNGLKASLSEAMAVREALQGPLASLPAEVMIAPPATLIAGFAA
ALGSGPVLLAGQDCHPKPSGAHTGDIAAEMLRDAGASAVIVGHSERRTDHRETSADVRAK
AEAAHRAGLVAIVCIGETHAERLAGSTLAVVCGQLEESMPESSTAANTVVAYEPVWAIGT
GLTPSPDDVKDVHGAIRARLVAQFGAEGEVMRILYGGSVKPDNAATLMAVENVDGALVGG
ASLKASDFLAIVRAYENV
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaactgggcgcggaattcggcctctggttgcgggaaactggaaaatgaacggc
ctgaaggcgagcctcagtgaggcgatggccgtgcgggaggcccttcaagggccgctcgcg
tcgctccctgccgaggtgatgatcgccccacccgcgacgctgattgccgggtttgcggcg
gcgctggggagcggcccggtgctgctcgccgggcaggactgtcacccgaagccgtcaggc
gcccatacgggcgatatcgccgccgaaatgctgagagatgcgggggcctcggccgtcatc
gttgggcattccgaacggcgaaccgatcaccgcgagacgagtgcagacgtcagggcgaaa
gccgaagccgcccaccgcgcagggctcgttgctatcgtttgtatcggggagacgcatgcg
gagcgactcgctggttcgacgctcgccgttgtgtgtgggcaactcgaggaatcgatgccg
gaatcgtccaccgcggcgaatacggtcgtcgcctatgagccggtctgggccatcgggacc
gggctgacgccatctccggacgacgtgaaagacgttcatggagcgattcgcgcgcgcctg
gtcgcacagttcggtgcggaaggcgaggtgatgcgcattctctacggcgggtcggtcaaa
cccgacaacgcggcgacgctgatggcggtggaaaacgtcgatggcgcgctcgtcggtggc
gccagccttaaggcgagcgattttctcgccatagttcgggcatatgagaacgtctga

DBGET integrated database retrieval system