KEGG   Hyphomicrobium sp. MC1: HYPMC_2195Help
Entry
HYPMC_2195        CDS       T01557                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
hmc00071  Fatty acid degradation
hmc00072  Synthesis and degradation of ketone bodies
hmc00280  Valine, leucine and isoleucine degradation
hmc00310  Lysine degradation
hmc00362  Benzoate degradation
hmc00380  Tryptophan metabolism
hmc00620  Pyruvate metabolism
hmc00630  Glyoxylate and dicarboxylate metabolism
hmc00640  Propanoate metabolism
hmc00650  Butanoate metabolism
hmc00900  Terpenoid backbone biosynthesis
hmc01100  Metabolic pathways
hmc01110  Biosynthesis of secondary metabolites
hmc01120  Microbial metabolism in diverse environments
hmc01130  Biosynthesis of antibiotics
hmc01200  Carbon metabolism
hmc01212  Fatty acid metabolism
hmc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HYPMC_2195
   00630 Glyoxylate and dicarboxylate metabolism
    HYPMC_2195
   00640 Propanoate metabolism
    HYPMC_2195
   00650 Butanoate metabolism
    HYPMC_2195
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HYPMC_2195
   00072 Synthesis and degradation of ketone bodies
    HYPMC_2195
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HYPMC_2195
   00310 Lysine degradation
    HYPMC_2195
   00380 Tryptophan metabolism
    HYPMC_2195
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HYPMC_2195
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HYPMC_2195
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HYPMC_2195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hmc04147]
    HYPMC_2195
Enzymes [BR:hmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HYPMC_2195
Exosome [BR:hmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HYPMC_2195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: CCB65417
UniProt: F8JF62
Position
complement(2069498..2070901)
Genome map
AA seq 467 aa AA seqDB search
MGVPDEPRYLIHRENYHPTSNPSPSRGGGLTETLMARELRRVAVIGGTRIPFCRSNTFYA
DQSNLDMMAGALNGLVDRYGLKGQHIDEVVGGAVVTHSKDFNLAREAVLSTKLAPSTPGV
TLIQACGTSLQSALMSAAKIATGEIESAISVGSDTTSDAPIVFTKKFSKRLIEAQQGKSA
MDKLKAFKGLAPAELAPQPPAVSEPRTGLSMGQHCELMAQEWHIPRADQDQLAFESHRKG
AAAYDEGYMDDLVIPFAGVYRDNNLRPDITLEKLASLKNAFEKSDRGTLTAGNSTPLTDG
AASVLLASEEWAKARNLPIQAYITYGQHVANNFVGGDGLLMAPTIAVSKMLDRAGLTLQD
FDFYELHEAFAAQVLCTLKAWEDPVYCKQHMGKDAPLGSIDRSKLNVKGSSLAFGHPFAA
TGARIVANLAKLLSTKGGRGLISVCTAGGMGVTAIMESPMTIEAQAA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gtgggggtacccgacgaaccgcgatacctcattcatcgcgaaaattatcaccccacctct
aacccctccccgtcgaggggagggggattgacggagacactgatggcaagagaacttcgg
cgcgttgcggtgatcggcggtactcgcattccgttctgccgttcgaacacgttttacgcc
gaccagtcgaacctcgacatgatggcgggcgcattgaacggattggtcgaccgctatggc
ctcaagggccagcacatcgacgaagtcgtcggcggcgcggtcgtcacgcactcgaaggat
ttcaacctcgcgcgcgaagcggtgctctcgactaagctcgctccttcgacacctggcgtc
acgctgatccaggcgtgcggaacgtcgctgcaatcggcgctgatgtcggcggccaagatc
gcaaccggcgaaatcgaaagcgctatttccgtcggctccgacacgacgtcggacgcaccg
atcgtcttcacgaagaaattttccaaacgcctcatcgaagcccagcagggtaagtcggca
atggacaagctcaaggccttcaaaggcctggcgcctgccgagcttgcgccgcagccaccc
gccgtctccgagccccgtacgggcttgtcgatgggtcagcattgcgaactgatggcgcag
gaatggcatattccgcgcgccgaccaggatcagctcgcgttcgaaagccaccggaagggc
gccgccgcctacgacgaaggctacatggatgacctcgtcattcccttcgcgggcgtctat
cgcgacaataacctgcgcccggacatcacactcgaaaagctcgcatcgctgaaaaacgcc
ttcgagaaatcggatcgcggcacgctgacggccggtaactcgacaccgctgacagacggc
gcggcaagcgttctgctcgcgtccgaagaatgggcgaaagcgcgcaatctgccgatccag
gcctacatcacctacgggcagcatgtcgcgaataatttcgtcggcggcgacggcctgctc
atggcgccgaccattgcggtctcgaagatgctcgaccgggcaggcctcacacttcaagat
ttcgacttctacgaactgcacgaagccttcgccgcgcaggtgctgtgcacgctgaaggcg
tgggaagatcccgtttactgcaagcagcatatgggcaaggacgcgccgctcggctcgatc
gaccgctcgaagctcaacgtcaaaggttcgtcgctcgcatttggccacccgttcgccgcg
accggcgcccggatcgtggccaacctcgctaagctgttgtcgaccaaaggcggccgcggg
ctcatttcggtctgcacggctggcggcatgggcgtgacggcgatcatggaatccccaatg
accatcgaggctcaggccgcctga

DBGET integrated database retrieval system