KEGG   Hyphomicrobium sp. MC1: HYPMC_2323Help
Entry
HYPMC_2323        CDS       T01557                                 

Definition
(GenBank) putative Phosphomannomutase/phosphoglucomutase (AlgC)
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
hmc00010  Glycolysis / Gluconeogenesis
hmc00030  Pentose phosphate pathway
hmc00051  Fructose and mannose metabolism
hmc00052  Galactose metabolism
hmc00230  Purine metabolism
hmc00500  Starch and sucrose metabolism
hmc00520  Amino sugar and nucleotide sugar metabolism
hmc00521  Streptomycin biosynthesis
hmc01100  Metabolic pathways
hmc01110  Biosynthesis of secondary metabolites
hmc01120  Microbial metabolism in diverse environments
hmc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HYPMC_2323
   00030 Pentose phosphate pathway
    HYPMC_2323
   00051 Fructose and mannose metabolism
    HYPMC_2323
   00052 Galactose metabolism
    HYPMC_2323
   00500 Starch and sucrose metabolism
    HYPMC_2323
   00520 Amino sugar and nucleotide sugar metabolism
    HYPMC_2323
  Nucleotide metabolism
   00230 Purine metabolism
    HYPMC_2323
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HYPMC_2323
Enzymes [BR:hmc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HYPMC_2323
    5.4.2.8  phosphomannomutase
     HYPMC_2323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_II PGM_PMM_I PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: CCB65543
UniProt: F8JGP6
Position
2193232..2194737
Genome map
AA seq 501 aa AA seqDB search
MLPKPRADLKANTADFERLPLVKPTGFREYDARWLYPQEINLMGLNAVGLGMATLFARRG
VPKRIVVGHDYRSYSAAVKQALMTGLLAGGCEVHDIGLALSPMAYFAQFELDVEGVAMVT
ASHNDNGWTGIKMGLSRPLTFGPDDMSELKSIVLNGEFEAKTGGRYIFVSDLAERYTKAL
TNRPKLKRRLKVVAACGNGTAGAFAPQVLEAIGCEVVPLNTDLDYTFPNHNPNPEDMKML
HAVSAKVLETGADVGLAFDGDGDRCGVVANDGHEIFADKVGVMLARDISAIHKKAKFVVD
VKSTGLFTTDPVLIANGATTSYWKTGHSYIKRYNFEHKTLVGFEKSGHFFFNEPLGRGYD
DGLVSAIAVCDMLDRSPGKTVADLRDALPKTYGSPTMSPHCDDEKKYGVVDRITEHYTKQ
KESGGTIAGQAIRDLITVNGVRVMLEDGTWGLVRASSNKPELVVVVESPTSEANMKAIFK
DIDQQLSRFPEVGEYNQKIAV
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgctaccgaagccacgcgctgacctgaaggccaacaccgccgacttcgagcgccttccg
ctcgtcaagccgaccggcttccgcgaatacgacgcgcgctggctctacccgcaggaaatc
aacctgatgggcctcaatgccgtcgggctcggcatggcgacgctgtttgcgcgccgaggc
gtgccgaaacgcatcgtcgtcggccacgactaccgctcgtactccgccgcggtgaagcag
gcgctgatgaccggcctgctcgccggcggatgcgaggtgcatgacatcggcctcgcgctg
tcgccgatggcctacttcgcgcagttcgaactcgacgtcgaaggcgtcgcaatggtgacg
gcaagccataacgataatggctggaccggcatcaagatgggattgtcgcggccgctgacg
ttcggacccgacgatatgtccgaattgaagtcgatcgttctcaacggtgagttcgaagcc
aagaccggcgggcgctatatcttcgtttccgatcttgccgagcgctataccaaggcgctg
accaatcgcccgaagctgaagcgccgcttgaaggtcgtcgcggcttgcggcaacggcact
gcgggcgcctttgcaccgcaagtgctggaagcgatcggctgcgaagtcgtgcccctcaac
accgatctcgactacaccttcccgaaccacaatccgaaccccgaagacatgaagatgctt
catgcggtctctgcaaaggttctcgaaaccggcgcggatgtcggcttggccttcgacggc
gacggcgaccgttgcggtgttgttgccaacgacggccatgaaatcttcgcggacaaggtc
ggcgtgatgctggcgcgcgatatttcggcgatccacaagaaggcaaagtttgttgtcgac
gtaaagtcgacgggcctgttcacgaccgatcccgtgctgatcgctaacggggcgacgacg
agctattggaagaccggccacagctacatcaagcgctataatttcgaacacaagacgctg
gtcgggttcgaaaagtcgggccacttcttcttcaatgagccgcttggccgcggctacgac
gatggcctcgtttcagcgattgccgtttgcgacatgctcgatcgcagtcctggaaaaacg
gttgccgatctgcgcgacgcgcttcccaaaacctacggctcgccgacgatgtcgccgcat
tgcgacgacgagaaaaagtacggcgtcgttgatcggatcaccgagcactatacgaaacag
aaagagagcggaggcacgattgcaggccaggcgatccgcgatctcatcaccgtcaacggc
gtgcgcgtgatgctggaagacgggacgtggggccttgtccgcgcatcatcgaataagccg
gagttggtcgttgtggtcgaaagcccgacctcggaagccaatatgaaggcgatcttcaag
gacatcgaccagcagctttcgcgcttccccgaagtcggcgaatacaatcagaagatagct
gtttaa

DBGET integrated database retrieval system