KEGG   Hyphomicrobium sp. MC1: HYPMC_4284Help
Entry
HYPMC_4284        CDS       T01557                                 

Gene name
phaA
Definition
(GenBank) beta-ketothiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
hmc00071  Fatty acid degradation
hmc00072  Synthesis and degradation of ketone bodies
hmc00280  Valine, leucine and isoleucine degradation
hmc00310  Lysine degradation
hmc00362  Benzoate degradation
hmc00380  Tryptophan metabolism
hmc00620  Pyruvate metabolism
hmc00630  Glyoxylate and dicarboxylate metabolism
hmc00640  Propanoate metabolism
hmc00650  Butanoate metabolism
hmc00900  Terpenoid backbone biosynthesis
hmc01100  Metabolic pathways
hmc01110  Biosynthesis of secondary metabolites
hmc01120  Microbial metabolism in diverse environments
hmc01130  Biosynthesis of antibiotics
hmc01200  Carbon metabolism
hmc01212  Fatty acid metabolism
hmc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HYPMC_4284 (phaA)
   00630 Glyoxylate and dicarboxylate metabolism
    HYPMC_4284 (phaA)
   00640 Propanoate metabolism
    HYPMC_4284 (phaA)
   00650 Butanoate metabolism
    HYPMC_4284 (phaA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HYPMC_4284 (phaA)
   00072 Synthesis and degradation of ketone bodies
    HYPMC_4284 (phaA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HYPMC_4284 (phaA)
   00310 Lysine degradation
    HYPMC_4284 (phaA)
   00380 Tryptophan metabolism
    HYPMC_4284 (phaA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HYPMC_4284 (phaA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HYPMC_4284 (phaA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HYPMC_4284 (phaA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hmc04147]
    HYPMC_4284 (phaA)
Enzymes [BR:hmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HYPMC_4284 (phaA)
Exosome [BR:hmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HYPMC_4284 (phaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CCB67493
UniProt: F8JA70
Position
4116202..4117392
Genome map
AA seq 396 aa AA seqDB search
MRQDPIVIVSAVRTPLGRFLGDLAPLQASELGAHAIRAALERAKLAPEKVDEVLFGNVLT
AGQGQAPARQAARAAGLPDATGATTVNKVCGSGMKATFLAHDLLAAGSADIVVSGGMESM
SNAPYLLQRARAGFRVGHGQVLDHMLLDGLEDAYEKGRSMGDFGEATAEAYQFTRADQDA
FAVETLTRARSAIQSGAFKAEIAPIRIATKEGEKVVVDDENPLKVSPEKVPKLKPAFRPN
GTITAASSSANADGAAALVLTRRSLAERERLPILAEIRAHATHSQEPAWFTTAPIPAIRK
ALAKAGWEAGDVDLYEINEAFAAVAMAAQKDLSIARDKLNVNGGACALGHPIGATGARLI
VTLLHALERQGATKGIASACIGGGEATAIAIERVGH
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaggacccgattgtcatcgtatctgcggttaggacgcctctcgggcggtttctg
ggcgatcttgccccgctccaggcttcggaactcggcgcgcacgccatccgggccgcactg
gaacgggctaagctggcgccagagaaagtggacgaggttcttttcggtaatgtgctgacg
gcgggacaggggcaggcgccggcacggcaggccgcacgcgctgccggactgcccgatgcg
acgggtgcgacgaccgtaaacaaggtttgtgggtcaggcatgaaagccacgtttctcgcc
cacgatctgctcgccgcgggctcggctgatatcgtcgtctcgggcggcatggaatcgatg
tcgaacgcgccgtatctgctgcagagggcccgtgcgggttttcgcgtcgggcacggacag
gtgctcgatcacatgctactcgacggcctcgaagatgcttacgaaaaaggccgcagcatg
ggcgatttcggcgaggcaacggctgaggcctatcagttcacgcgggcggatcaggatgcg
ttcgcagtcgagacactgacgcgcgcgcgctccgctattcagtccggagcattcaaagcc
gagattgctccgatccgcatcgcgaccaaagagggcgagaaggtcgtggtcgatgacgag
aacccgctcaaggtctcaccggagaaagttccgaagctgaaaccagcgttccggccgaac
ggcacgataaccgcggccagctcgtcggcaaacgccgatggggcggcagctctggttcta
acgcgccgctcgcttgcagagcgcgaaagactaccgattcttgcagagatccgcgcacac
gccacgcacagtcaggagccggcctggttcacgaccgcgccaattcccgccattcgcaaa
gccttggcaaaggcggggtgggaggctggggacgtcgatctttacgagatcaatgaagcg
ttcgcggcggtcgcgatggccgcgcagaaggatctttcgatcgcgcgcgataagctcaac
gtcaatggcggcgcgtgtgcactcggacacccgatcggtgcaacgggcgcgcggttgatc
gtgactctgctgcacgcgcttgagcggcagggagcgacgaaagggatcgcgtcggcttgt
atcggcggtggcgaagcgaccgcaatcgctatcgagcgcgttgggcattga

DBGET integrated database retrieval system