KEGG   Hyphomicrobium sp. MC1: HYPMC_4437Help
Entry
HYPMC_4437        CDS       T01557                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
hmc00780  Biotin metabolism
hmc01100  Metabolic pathways
Module
hmc_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:hmc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HYPMC_4437
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hmc01007]
    HYPMC_4437
Enzymes [BR:hmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     HYPMC_4437
Amino acid related enzymes [BR:hmc01007]
 Aminotransferase (transaminase)
  Class II
   HYPMC_4437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_3 Cys_Met_Meta_PP SHMT Beta_elim_lyase Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: CCB67646
UniProt: F8JC26
Position
4273600..4274733
Genome map
AA seq 377 aa AA seqDB search
MPGNHERALDALSRRGRLRTLEPAHGLDFTSNDYLGLAQSRALADAIEGAIARGVPVGSG
GSRLLRGNHAEHELLEQEAAHFFGGETALYFGGGFIANTALFSTLPARGDLIVYDELIHA
SAHEGMRLSKAEAKAVRHNDAQGVDDAITAWRATGGTGQPWIAIESLYSMDGDRAPIAEL
ATIADRHEAMLIVDEAHATGVLGPDGRGLAADLEGRENVVTVHTCGKALGAMGALVIAPR
TIRDFLVNRGRAFVYATAPSPLMAAAVRAALNICRNDPLRRQRLHDLVAFAARELTTKTR
FAASGSQIQPLIIGSDGTAMALATAMKTRGYDIRAIRPPTVPEGTSRLRLTITLNVSELE
ITRLIDDLAAAEAENAA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcaatcatgagcgtgcgctcgacgcgctctcccgccgtgggcgtctgagaacg
ctcgaaccggcgcacggactggatttcacgtcgaacgattatctcggcttggcgcaatcg
cgcgcgcttgccgacgccatcgaaggggcgattgcgcgtggcgttccggtcggctcgggc
ggatcgcgtctgttgcgcggcaatcatgctgagcacgagcttttagagcaggaagcggcg
cacttcttcggcggcgagaccgcgctttatttcggtggcggcttcattgccaataccgcg
cttttttcgacgttgcctgcacgcggcgatctcatcgtctacgatgagttgatccacgcc
agcgcgcatgaaggcatgcggctgtcgaaggctgaggcaaaggccgtgcgccataacgat
gcgcaaggtgttgacgacgcgatcacggcatggcgcgcgaccggcggcaccgggcagccg
tggattgcgatcgagagcctctacagcatggacggtgatcgcgcgccgatagcggaactc
gcgacaatcgcggatcgtcatgaggcgatgctgatcgtcgacgaagcacatgccacgggc
gtgctcggtccggatgggcgcggcctcgccgccgatctcgaaggccgcgaaaacgtcgtc
acggtgcatacatgcggaaaggcgttgggcgcgatgggcgcgcttgtgattgcgccgcgc
actatccgcgattttctggtcaatcgcggtagagcctttgtttacgcgacggcaccgtcg
ccgctgatggctgccgccgtgcgcgcggcgctcaacatttgccgcaacgatccgctgcgg
cgccagcgcttgcacgatctcgtcgcgtttgccgcgcgggaactgacgacgaaaacgcgc
tttgcggcttccggctcgcagatccagccacttatcatcggcagcgacggcacggcgatg
gcgcttgcgacagcgatgaagaccaggggttacgacatccgcgcgatccgtccgccgacc
gtgccggaaggcacgtcacggcttcgactcacgattacgctcaatgtttccgagcttgaa
attacgcgcctcatcgacgatctcgcggcggctgaagcggagaatgcagcatga

DBGET integrated database retrieval system