KEGG   Hyphomicrobium sp. MC1: HYPMC_4524Help
Entry
HYPMC_4524        CDS       T01557                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
hmc00020  Citrate cycle (TCA cycle)
hmc00310  Lysine degradation
hmc01100  Metabolic pathways
hmc01110  Biosynthesis of secondary metabolites
hmc01120  Microbial metabolism in diverse environments
hmc01130  Biosynthesis of antibiotics
hmc01200  Carbon metabolism
Module
hmc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hmc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HYPMC_4524 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    HYPMC_4524 (sucB)
Enzymes [BR:hmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HYPMC_4524 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: CCB67733
UniProt: F8JD06
Position
complement(4351961..4353244)
Genome map
AA seq 427 aa AA seqDB search
MSIEIRVPTLGESVTEATVGKWFKNSGDAVNADEPLVELETDKVTVEVPAPASGVLGEIL
VQSGSTVEVGALLAALNEGGAAAAPAKSEAKAAPPPPPQPAPAPAAAQAPPPPPPAAQKA
LTEAGLEASDIQGSGRRGQVLKEDVLAAVASSARPAAPPPVHESAPATNVVAIPTAPALK
AVPQETRLPSPGNDVAREERVKMTRLRQTIARRLKDAQNTAAMLTTFNDVDMSAVMALRS
QYKDIFEKRYGVKLGFMGLFVKACIQALRDVPAVNAEIDGDELIYKNYYHIGVAVGTEKG
LVVPVVRDADRLSLAGIEQQINEFGKRARDGRLSIEDMQGGTFTISNGGVYGSLMSTPIL
NAPQSGILGMHRIEERPVVKKGQIVARPMMYLALSYDHRIVDGKEAVTFLVRVKECLEDP
QRFILEL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcgagatccgcgttcccacgctcggtgagagcgtcacggaagcgactgtaggc
aagtggttcaagaactccggcgatgcagtcaacgcggacgagccgcttgtcgagctggaa
accgacaaggtaaccgtcgaagttccggcacccgccagcggcgttctcggcgaaattctg
gtgcaatcgggttcgaccgttgaagtcggcgccctgctcgccgccttaaacgaaggcggc
gccgcggcggcaccagccaagagcgaagccaaagccgctccgcctccgccgcctcaacca
gcgccggctcctgccgcggctcaagcccctccgccgccaccgcctgcagcccagaaggcc
ctgaccgaagcaggtctcgaagcatccgacattcaaggctccggccgccgcggccaggtg
ctgaaggaagacgtcttggcagcggtcgcgtcatcggcgcgtcccgccgccccgccgccg
gtgcatgaatccgctccggcaacgaacgtcgtcgcgatcccgaccgctcccgccttgaaa
gccgtcccgcaggaaacgcgcctgccctcgccgggcaacgacgtcgcccgcgaagagcgc
gtgaagatgacgagactgcgccagaccatcgcgcggcgcctgaaggacgcgcagaacacc
gccgccatgctgacgacgttcaacgacgtcgatatgagcgcggtgatggcgctccgctcg
caatacaaagatattttcgagaagcgctacggcgtgaagctcggtttcatgggcctgttc
gtgaaggcctgcatccaggcgctgcgcgatgtgccagccgtcaatgccgaaatcgacggc
gatgaactgatctacaagaattactatcacatcggcgtcgccgtcggcaccgagaagggc
ctcgtcgtcccggtcgtgcgcgacgccgaccgcctcagcctcgcgggcatcgagcagcag
atcaacgagttcggcaaacgcgcccgcgatggccgcctctcgatcgaagacatgcagggc
ggcacattcacgatctcgaacggcggcgtctacggctctctgatgtcgacgccgattctg
aatgcgccgcagtccggcatcctcggcatgcaccgcatcgaggaacgccccgttgtcaag
aaaggccagatcgtcgcccgtccgatgatgtacctcgcgctctcctacgatcaccgcatc
gtcgacggcaaggaggccgtcaccttcctcgtccgcgtcaaggaatgcctggaagatccg
cagcgcttcatcctggagctttaa

DBGET integrated database retrieval system