KEGG   Hyphomicrobium sp. MC1: HYPMC_4808Help
Entry
HYPMC_4808        CDS       T01557                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
hmc00010  Glycolysis / Gluconeogenesis
hmc00620  Pyruvate metabolism
hmc00640  Propanoate metabolism
hmc00680  Methane metabolism
hmc01100  Metabolic pathways
hmc01110  Biosynthesis of secondary metabolites
hmc01120  Microbial metabolism in diverse environments
hmc01130  Biosynthesis of antibiotics
hmc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HYPMC_4808 (acs)
   00620 Pyruvate metabolism
    HYPMC_4808 (acs)
   00640 Propanoate metabolism
    HYPMC_4808 (acs)
  Energy metabolism
   00680 Methane metabolism
    HYPMC_4808 (acs)
Enzymes [BR:hmc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HYPMC_4808 (acs)
Lipid biosynthesis proteins [BR:hmc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HYPMC_4808 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CCB68016
UniProt: F8JGB7
Position
complement(4614354..4616300)
Genome map
AA seq 648 aa AA seqDB search
MSDKVYAVPQAWAERAYVNDQSYDAMYQRSISDPEGFWSEAGKRLHWITPYTRAKNTSFA
PGNVDIRWFEDGTLNVSANCIDRHVESRGDKVAIIWEGDNPNESEQITYRQLHERVQRFA
NVLKKLGVKKGDRVTIYLPMIPEAAYAMLACTRIGAIHSIVFGGFSPDSLQNRVEDAESK
LIITADEGLRGGKSVPLKKNCDAALVKCKGDEKVLVVRRTGNPVPWTPGRDFWLHEELIT
VPAECEPEEMRAEDPLFVLYTSGSTGKPKGVVHTTGGYLVYASMTHQYVFDCRDDDVYWC
TADVGWVTGHSYIVYGPLANGATTLMFEGIPTYPSASRFWDVVDKWKVSIFYTAPTAIRS
LMGAGNELVNKSSRASLRLLGSVGEPINPEAWEWYHNVVGEGRCPIVDTWWQTETGGILI
APLPGATPLKPGSATKPFFGVKPALVDDKGKILDGDTQGNLVILDSWPGQSRTVYGDHDR
FVQTYFSAYPGMYFTGDGCRRDADGYYWITGRVDDVINVSGHRMGTAEVESALVSHPKVA
EAAVVGYPHDLKGQGIYCYVTLNTGENGDDALKKDLVAHVRREIGPIASPDLIQFSPGLP
KTRSGKIMRRILRKIAEDDYGSLGDTSTLADPAVVDDLITNRQNRRMI
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgtcggataaagtttatgccgtcccccaggcgtgggcggagcgggcttacgtcaatgat
cagtcttatgacgcaatgtatcagcggtcgatcagcgaccctgagggcttctggtcggaa
gctggtaagcggttgcactggatcacaccctatacgcgcgccaagaacacaagcttcgcg
ccgggcaacgttgacatccgctggttcgaagacgggacgctgaatgtctcggcgaactgc
atcgaccgtcacgttgaatcgcgcggcgataaggttgccatcatctgggaaggcgacaac
ccaaacgagagcgagcaaatcacctaccgccagctccacgagcgggttcagcgtttcgcc
aatgtcttgaagaagctcggcgtcaagaaaggggaccgcgtcaccatctacctgccgatg
atccctgaagcagcctatgccatgctcgcctgcacgcggatcggcgccatccattcgatc
gtgttcggcggcttctcgcctgacagccttcagaaccgggtcgaagacgcagaatcgaag
ctcatcatcacggccgacgaaggcctccgcggcggcaagtccgttccgctcaaaaagaat
tgcgacgcggcgctggtgaaatgcaagggtgacgagaaagttctcgttgtccgccgcacc
ggcaatcccgtgccttggacgccgggccgcgatttctggctgcacgaagaactcatcacc
gtcccagccgagtgcgagccggaggaaatgcgcgccgaggatccgctgttcgtgctttac
acgtcgggctcgacgggtaagccgaagggcgtcgtccacacgacgggcggctatctcgtc
tacgcttcgatgacgcatcaatatgttttcgattgccgcgacgacgatgtttactggtgc
accgccgacgtcggctgggtcaccggccatagctacatcgtctatggcccgctcgcgaac
ggcgccacgacgctgatgttcgaaggcatcccgacctacccatcggcttcccgcttctgg
gacgttgtcgacaagtggaaggtctcgatcttctacaccgcgccaaccgctattcgctcg
ctgatgggcgcgggcaacgaacttgtaaacaaatcgagccgcgcatcgctgcgtctgctg
ggatcggtcggcgagccgatcaaccccgaagcttgggaatggtatcataacgtcgtcggc
gaaggccgctgcccgatcgtcgatacgtggtggcaaacggaaaccggcggcattttgatt
gcgccgcttcccggcgcaacgccgctaaaacctggttccgccacgaagccgttctttggt
gtgaaaccggcgcttgtcgatgacaaaggcaagatcctcgacggcgacacgcaaggaaac
ctcgtcatcctcgatagctggccgggccagtcgcgcaccgtctacggcgatcacgatcgc
ttcgtgcagacctacttctcggcttatcccggcatgtacttcacaggcgacggctgtcgc
cgcgacgccgacggctattattggattacaggccgcgtcgacgacgtcatcaacgtgtcg
ggccatcgcatgggcacggcggaagtcgaaagcgcactcgtttcgcatccaaaggtcgcc
gaggcggccgtcgtgggctacccgcacgacctcaagggccaaggcatctactgctatgtc
acgctcaacacgggcgaaaatggcgatgacgctttgaaaaaggatctggtcgcccacgtt
cgccgggaaatcggcccgatcgcatcgcccgatctcatccagttctcacctggtctgccg
aagacgcgctcgggcaagatcatgcggcgtatcctccgcaagatcgccgaagacgattac
ggtagcctgggagacacatcgaccctcgccgatccggccgtggtcgacgacctcatcaca
aaccgtcagaaccggcgcatgatctga

DBGET integrated database retrieval system