KEGG   Haloferax mediterranei: HFX_0370Help
Entry
HFX_0370          CDS       T02129                                 

Gene name
nagC
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hme  Haloferax mediterranei
Pathway
hme00010  Glycolysis / Gluconeogenesis
hme00052  Galactose metabolism
hme00500  Starch and sucrose metabolism
hme00520  Amino sugar and nucleotide sugar metabolism
hme00521  Streptomycin biosynthesis
hme01100  Metabolic pathways
hme01110  Biosynthesis of secondary metabolites
hme01120  Microbial metabolism in diverse environments
hme01130  Biosynthesis of antibiotics
hme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFX_0370 (nagC)
   00052 Galactose metabolism
    HFX_0370 (nagC)
   00500 Starch and sucrose metabolism
    HFX_0370 (nagC)
   00520 Amino sugar and nucleotide sugar metabolism
    HFX_0370 (nagC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HFX_0370 (nagC)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HFX_0370 (nagC)
Enzymes [BR:hme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HFX_0370 (nagC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: AFK18106
UniProt: I3R1J6
Position
347862..348830
Genome map
AA seq 322 aa AA seqDB search
MAYYVGVDLGATNVRSVVADDEGTVLGQSRDRTPRGPTGIAVTEAVLGVVREACDEAGID
PSEAVAAGIGAIGPLDLAEGAVENPANLPDTIDRIPLTGPISVLLDTDEVYLHNDTNAGV
IGERFHSDRNPDDMVYLTISSGIGAGVCVDGHIIDGWDGNAGEVGHMTLDPHGFMTCGCG
HDGHWEGYCSGNNIPKYARELHEEDPVETALPVENPTFSAVDVFEHAGKDDFADHVISQL
GHWNAMGVANIVHAYAPLIIYVGGAVALNNPDLVLDPIREQMSNMVMSNIPEIQLTTLGD
EVVVEGALASAMTAGTGDRSRL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcgtactacgtgggcgtcgacctgggggcgacaaacgtccgttcggtggttgccgac
gacgagggaacagtcctcgggcagtcccgtgatagaactccacgcgggccgacaggtatc
gcagttaccgaggcagtgctcggcgtcgtccgtgaggcatgtgacgaagcgggtatcgac
ccgagcgaggcagttgccgccggtatcggcgcgattggtccgctcgacttggctgagggt
gcagtcgagaacccggcgaacctcccggacaccatcgaccggattccgttgaccggtccg
atttcggtgctcctcgatacggacgaagtgtacctccacaacgacaccaacgccggcgtc
atcggcgagcggttccactcggaccggaaccccgacgatatggtgtatctcactatctcc
tccggtatcggtgcgggtgtctgtgtggacgggcacatcatcgatgggtgggacggcaac
gccggtgaagtcggtcacatgacgctcgacccccatggcttcatgacgtgtgggtgtggt
cacgacggacactgggagggctactgttcggggaacaacatcccgaaatacgcccgcgaa
cttcacgaagaagaccccgtcgaaaccgcgttgccggtagaaaacccgacgttctccgca
gtggacgtgttcgaacacgctggcaaggacgacttcgccgaccacgtcatcagccaactg
ggccactggaacgcgatgggcgtcgccaatatcgttcacgcgtacgccccgcttatcatc
tacgtcggcggcgcagtcgcactcaacaaccccgacttggtgttggacccaatccgagaa
cagatgagcaacatggttatgtcgaacattcctgagattcaactcacgacgctcggcgac
gaagtggtcgtcgagggtgcactcgcaagtgcgatgaccgctgggaccggagaccgctca
cggctgtaa

DBGET integrated database retrieval system