KEGG   Haloferax mediterranei: HFX_1351Help
Entry
HFX_1351          CDS       T02129                                 

Gene name
nagD
Definition
(GenBank) putative sugar phosphatase of HAD superfamily
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
hme  Haloferax mediterranei
Pathway
hme00627  Aminobenzoate degradation
hme01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hme00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    HFX_1351 (nagD)
Enzymes [BR:hme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     HFX_1351 (nagD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 PGP_phosphatase
Motif
Other DBs
NCBI-ProteinID: AFK19062
UniProt: I3R4A2
Position
1273534..1274313
Genome map
AA seq 259 aa AA seqDB search
MEFRGVVLDVDGTVVRGDEAIPGALDGLSAIEAAGLDRLFVSNNPTKAPPLYEARLRGAG
VDATADEIVTSGTTTTAYLADNHPGARTFCIGESGLHDQLRDAGLELVGAHDDPEVVVVA
IDREFHYDDLRDASVALRGGATFYGTDPDILIPAADGDIPGSGAIINAVAGVAERDPDAI
LGKPSSVAREYVLDRLGLPPEDVLIVGDRLDTDIALGLAAGMGTAVVRTGVTDDAALEQS
EYEPDYVLDGLGDIERIIS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggagttccgaggtgtcgtcctcgacgtggacggaacagtagttcgtggtgacgaagcg
attcccggcgcgctcgacgggctttcggctatcgaggccgccggactggaccgcctgttc
gtctcgaacaacccgacgaaagccccgccactgtacgaagcgcgactccggggggccggt
gtcgatgcgaccgccgacgaaatcgtcacctccgggacgacgacgacggcgtatctcgcc
gacaaccatcccggtgcgcggactttctgtatcggcgaatcgggattacacgaccaactc
agagacgcgggtctcgaactcgtcggcgcacacgacgaccccgaagtcgtcgtcgttgcc
atcgaccgcgagttccactacgacgacctccgggacgcttcggtcgccctgcgcggtgga
gcaaccttctacgggaccgacccggacatcctcatccccgctgctgacggcgatattccc
gggtccggtgcaatcatcaacgccgtcgccggtgtcgccgagcgcgacccggatgcgatt
ctcggaaagccctcgtcggtcgcgcgcgagtacgtcctcgaccgactcggactcccgccc
gaagacgtgctcatcgtcggcgaccgcctcgataccgatatcgcgctcggtctcgccgca
ggaatggggaccgcggtggttcgaaccggcgtgactgacgatgcggcattggaacaaagt
gagtacgaacccgactacgtcctcgacggacttggcgacatcgagcgcatcatctcgtag

DBGET integrated database retrieval system