KEGG   Haloferax mediterranei: HFX_2691Help
Entry
HFX_2691          CDS       T02129                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
hme  Haloferax mediterranei
Pathway
hme00340  Histidine metabolism
hme01100  Metabolic pathways
hme01110  Biosynthesis of secondary metabolites
hme01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    HFX_2691 (hisD)
Enzymes [BR:hme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     HFX_2691 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFK20369
UniProt: I3R809
Position
complement(1966498..1967784)
Genome map
AA seq 428 aa AA seqDB search
MNIEVRELADLGPDARRAFFERDAGVGDVRSDVRDIVERVRREGDVALRDYSREFDDVEV
GNIDVSDAAERAYDEIDDDVREAIETAAANIREFHERQVPEDWREDFGASGTRELGRRYR
PLDRVGVYAPGGTAAYPSSVLMGVIPAKVAGVEHVAVATPPADTMNPVTLAAMHVAGADA
VYSVGGAQGIAALAYGTETVKAVQKVVGPGNKWVTAAKAEVRGDVDIDFLAGPSEVLVVA
DETAEARFVAADLVAQAEHDPNASVVAVTDDADLATEIVEEVERQAAERERTETIEAALE
NDASGVLVARSMSEAVLFAEEYAAEHLSIQADDDEALLDRIDSAGSVFLGPYTPVAAGDY
ASGTNHVLPTGAGAKQQGGLSVDHFVRSTTVQRLDQEALSGLSETVTTLAEAEGLDAHAQ
SVRERFEE
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgaggttcgcgaactggccgacctcggccccgacgctcgccgcgccttcttc
gaacgagacgccggcgtcggcgacgttcgctccgacgtacgcgacatcgtcgaacgagtc
cgcagggagggcgacgttgcgctccgggactactcccgcgagttcgacgacgtcgaagtc
ggcaacatcgacgtgagcgacgcggccgaacgcgcctacgacgaaatcgacgacgacgtg
cgcgaagctatcgagacggcggcggcgaacatccgcgaattccacgagcgacaggtcccc
gaagactggcgcgaggacttcggcgcttccggcacgcgcgaactcgggcgacgctaccgc
ccccttgaccgcgtcggcgtctacgcacccggcggtaccgcagcctacccgtccagcgtt
ctcatgggtgtcatccccgccaaagtcgcgggcgtcgagcacgtcgcggtcgccacgcca
ccggccgacacgatgaaccccgtcaccctcgctgcaatgcacgtcgcgggtgctgacgcg
gtgtactctgttggtggcgcacaaggcatcgccgctctcgcctacgggacagagaccgtg
aaggccgtccagaaggtcgtcggcccgggcaacaagtgggttacggccgcgaaggccgag
gttcgcggcgacgttgacatcgacttcctcgccggtccctccgaggtactcgtcgtcgcc
gacgagaccgcagaggcgcgattcgtcgcggccgacctcgtcgcacaggccgaacacgac
ccgaacgcttccgtggtcgccgtcaccgacgacgccgacctcgccacagaaatcgtcgag
gaggtcgagcgacaggccgcagagcgcgaacgcaccgagaccatcgaggcagcgctggag
aacgacgcttcgggcgtgctcgtcgcccgctcgatgtccgaagcggtgctcttcgccgaa
gagtacgccgcagagcacctgtcgattcaggccgacgatgacgaagctctcctcgaccgt
atcgactcggccggaagcgtcttcctcggtccgtacaccccagtcgccgcgggcgactac
gcctccggaacgaaccacgtgctaccgactggtgccggtgcgaagcaacagggcggactc
tcggtggaccacttcgtccgctcgacaactgtccagcgactcgaccaggaggcgctttcg
ggcctctcagagacggttacgacgctcgccgaagcggaaggactcgacgcgcacgcacag
agcgtccgcgaacggttcgaggagtaa

DBGET integrated database retrieval system