KEGG   Hydra vulgaris: 100197228Help
Entry
100197228         CDS       T01080                                 

Gene name
eif3c
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
hmg  Hydra vulgaris
Pathway
hmg03013  RNA transport
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100197228 (eif3c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hmg03012]
    100197228 (eif3c)
Translation factors [BR:hmg03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    100197228 (eif3c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 100197228
NCBI-ProteinID: XP_012560743
Position
Un
AA seq 806 aa AA seqDB search
YENLTKGYEKSKTIIQKEGIPNFFIKGLADLEDFIQQQWEDAEGRKKLSKLNAKALASLR
QKVKKFNREFEEKIVDYKKDPNKYEEVEEEEENEEDADQELDFEEVKPKSKVESAKPPRD
DDDDSDDFFGTDSDESSSDDELPEGGRRQWGAWMFLKDASSKDDKRKEKRVKRERPKETK
TVQDDGWTEVSKTSEKMRMLFPKDTEINHQVILKKFHEILAVRGKKGTDRSEQVDYFVQL
KNISEQHNLGPALCLKLLFNIASAIVDSSMGTDVALKPDMWNRLLDTAKEIYSLIAANPN
ILFNQSEYENVEDKTQQYQLLEDPITLLERLDNEFTKILQNCDGHSTEYIQKLKDELEIV
SLIDQVIQHHEKHPSSPETLSRLYLLRIEHTYFKVDLKQLKEIQSQIKLVEVKRLNEEQG
VASEKVESIKVDGHTTVEDSKDDHDSSLMSRMCKYIYSNGSDRIRTRAMLCHIFHHAKHN
RWFEARDLMLISHLQENIHHSDIPTQILYNRTMVQLGLCSFRHGMIKDAHNALQDIQSTG
RAKEMLAQGLMNLKNTERTPEQEKIEKRRMMPFHMHVNLELIECVFLTSAMLLEIPNMAA
NEYVYKRRPISKSFQNQLRHSEKQALVGPPESMREHIVAASKAMKVGDWKKCRDNILAVS
CWELFPNSDAVKSMITRKIQEESLRTYLFTYNKVYDSISMHSLAQMFDLPSSVVHSTISK
MIISEELQASWDEPTETLVLHHGAEPTYLQSLTLQLSDKLNTLVEHHERILDFKYGPIFN
KDVRKPDSRKPRNDNRSITQRRSVQI
NT seq 2423 nt NT seq  +upstreamnt  +downstreamnt
aatatgaaaatctaacgaaaggctatgaaaaatcaaaaacaattattcaaaaagaaggaa
ttccaaacttcttcattaaaggattagctgatttagaagactttattcagcagcaatggg
aagatgcagaaggcaggaaaaagctatcaaaattaaatgcaaaggctcttgcttcattgc
gacaaaaagttaaaaagtttaatcgtgagtttgaagagaagatagttgattacaaaaagg
atccaaataaatatgaggaggtagaagaagaagaggaaaatgaagaggatgcagatcaag
aattagattttgaagaagttaaacctaagagtaaagttgaatcagcaaaacctccacgtg
atgatgatgacgatagtgatgattttttcggaacagattcagatgagtcaagttctgatg
atgagctcccagaaggtggtcgtcggcaatggggtgcgtggatgtttttaaaagatgcgt
cttctaaagatgataaaagaaaagaaaaacgagttaaaagagagcgcccaaaagagacaa
agactgttcaagatgacggttggacagaagtctcaaaaacatcagaaaaaatgagaatgt
tatttccaaaagatactgaaattaatcatcaagtaattttgaagaaattccatgaaattc
ttgctgtccgaggaaaaaaggggactgaccgttctgaacaagttgactattttgtacagc
ttaagaatataagtgaacaacataatcttggtccagctctttgtttgaagcttttgttta
atattgcatcagctatagttgattcttctatgggaacagatgttgcacttaaaccagata
tgtggaacagacttttggatactgcaaaggagatatatagtctaatagcagccaatccaa
atatacttttcaatcaatctgagtatgaaaatgttgaggataaaactcagcaatatcaac
ttctagaagaccctataactttacttgagcggcttgataatgaattcaccaaaatacttc
aaaattgtgatggtcactcaacagaatatattcaaaaattaaaagatgaacttgaaattg
tttcacttattgatcaagtgatccaacatcatgaaaaacatccttcatcaccagaaacat
taagtcgactatatttacttagaattgaacacacttactttaaagtagatttaaagcagt
tgaaggaaattcaatcacaaattaaattagtcgaagtaaaacgtctaaatgaagaacaag
gtgttgcaagtgagaaagttgaaagtattaaagttgatggacatactacagtagaagaca
gtaaagatgatcatgactcttctcttatgtctcgaatgtgtaaatatatttactctaatg
gatcagatagaattcgaactcgtgctatgctttgtcacatttttcatcatgctaaacata
atcgttggttcgaagctcgagatttgatgttaatatctcatttacaagaaaatatacacc
attctgatatcccaactcagatattatacaatcgtactatggtacaacttggtttgtgtt
catttcgtcatggaatgattaaagatgctcacaatgctttacaagatatacaatctactg
gtagagcaaaagagatgcttgctcaaggacttatgaatctaaagaatacagagcgtaccc
ctgaacaagaaaaaattgaaaagcgaagaatgatgccatttcacatgcatgtaaatttgg
aattaattgaatgtgtttttcttacttcagctatgttgctcgaaattccaaatatggctg
ctaatgaatatgtctataaaagaagaccaataagtaagagttttcaaaaccagttgcgtc
atagtgagaagcaagcattagtagggcctcctgaaagtatgcgagagcacatagttgcag
cttcaaaagcaatgaaggttggtgattggaaaaaatgtagggataatattttagctgtct
catgctgggaactttttccaaattccgatgctgttaaaagcatgattacaagaaaaattc
aggaagagagtcttcgtacatacttatttacatacaacaaggtttatgattcaataagta
tgcatagtctagctcaaatgtttgatcttccatcttcagttgtccatagtactattagca
agatgatcattagtgaagaattacaggcatcttgggatgaacccactgaaactcttgtcc
ttcaccatggtgctgaacctacatacttacaaagcttaactttacagttgtcagataagt
tgaatacgttagtagaacaccatgaaagaatactcgattttaagtatggacctatcttca
ataaagatgtacgaaaaccagatagtcgcaaaccaagaaatgataatcgctctattactc
aacgacgaagtgttcaaatttaa

DBGET integrated database retrieval system