KEGG   Hydra vulgaris: 100198610Help
Entry
100198610         CDS       T01080                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
hmg  Hydra vulgaris
Pathway
hmg00010  Glycolysis / Gluconeogenesis
hmg00562  Inositol phosphate metabolism
hmg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100198610
   00562 Inositol phosphate metabolism
    100198610
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100198610
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100198610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 100198610
NCBI-ProteinID: XP_002167705
UniProt: T2M2X2
Position
Un
AA seq 433 aa AA seqDB search
MILGLILLIQFLKPSYGNECWNNPLFSSKTPYKLVGNMNLDVKYPDGCKPVQINLVHRHG
HRYPSRKNIIEFSDMFDILKSAHQASSKDFPTENPFTVDQDKLLTVVGEEEMYGIAQRIR
QRFPELFTQSYSSVFHKFESSCKSRCLHSSSAFAYGLFEGTGALGECRFQPVAVRTRPCD
VDMVLRFFQLCQKYVAEVEENKSAVTEMKKFGLGDEVQLVINKMKKKLGLPKIDIKLLKS
MFLFCAYEIGIFNGSTNSGLCSLFDNNDLQILEYYLDLKHYYRRFSAFPITYKSSCPLLA
DVVKHMKKASLNTTESLGGIFRSSHAETIMPFIALLGLNKDPVELRADNFNEMKSREFRP
SCISPFSGNVYFVLYDCGSKKHKIQLYMNEYLVKIPCCESMYECDFDTFLKCYESIVDNC
NFNEICSLKKTEL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgattttaggactaatactgcttattcaattcttaaaaccttcctatggtaatgagtgt
tggaacaatccactattttcttcaaaaactccatataagttagttggaaatatgaacttg
gatgtgaagtatccagatggttgtaaacctgttcaaataaatttagttcatcgccatggc
caccgttatcctagtagaaaaaatataattgagtttagtgatatgtttgacatccttaaa
tcagctcatcaagcatcatcaaaagattttcccactgaaaatccatttacagtagatcaa
gataaactactaactgtggtgggtgaagaagaaatgtatggtattgcacagagaatacgg
cagcgatttcctgagttatttactcagagttattcatcagtatttcacaagtttgaaagt
tcttgtaaatcacgttgcttgcatagctcaagtgcatttgcttatggtttatttgaaggc
actggtgctcttggagaatgccgctttcaaccagttgcagttagaactcggccatgtgat
gttgatatggtattaagattctttcagctttgtcaaaagtatgttgctgaagtcgaagag
aacaaatcagcagtcactgaaatgaaaaagtttggtttaggtgatgaagtccaacttgtc
attaataaaatgaagaaaaagcttgggctaccaaaaattgatataaaactattaaaatct
atgtttttgttttgtgcttatgagattggtatctttaatggaagtactaactctggttta
tgttctctatttgataataatgatttacaaattttggaatactatcttgatctgaaacat
tattacagaaggttttctgcttttcctataacttataaaagtagttgtcctttgttagct
gatgttgtaaaacatatgaaaaaagcttccttaaatacaactgaatcacttggtggtatt
tttcgatcttctcatgctgaaacaattatgccatttattgctttacttggcttaaataaa
gacccagttgaattaagagctgataattttaatgagatgaaaagcagagaatttcgacct
agctgtatatctccgttttctggaaatgtgtattttgttttgtatgattgtggtagtaag
aagcataaaattcaactttacatgaatgaatatttagttaaaataccttgctgtgaatct
atgtatgagtgcgactttgatacttttttgaaatgctatgaaagtattgtggataattgt
aactttaatgaaatttgtagtttaaaaaaaactgaactttag

DBGET integrated database retrieval system