KEGG   Hydra vulgaris: 100199919Help
Entry
100199919         CDS       T01080                                 

Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase-like
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
hmg  Hydra vulgaris
Pathway
hmg00510  N-Glycan biosynthesis
hmg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100199919
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hmg01003]
    100199919
Enzymes [BR:hmg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     100199919
Glycosyltransferases [BR:hmg01003]
 Glycan extension
  N-Glycan
   100199919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 100199919
NCBI-ProteinID: XP_002155135
Position
Un
AA seq 484 aa AA seqDB search
MICKRRIRKVFLILFPALLVVCFMVYLQNEGILYNNLENYSDKKDDSSMKLDVLKSLIDI
QKDSGEVKKINIPFEDDALLKKFLDEAKKTNDPFAQSENSNYFDFLDFKTDFSDTKYTAS
QLRSVIIELNERQLVYNNDKFSKREKEFVVIVVQVHKRIEYFKELLDSLQRSKGIENAIL
VISHDVYADSVNELIRKITFCQVIQIFFPYSMQMYPNEYPGPSENDCPRDISLSEARRIG
CNNAETPDSFGHYREAHITMTKHHWWWKINMVMDVLDATKNHDGPFMFIEEDHYMAPSFY
ESLMNLHKTKKSHPLCKTSCDILTIGSYAMNEETLNNVDEAYIGDWISTQHNMGMALYRS
TWNEIKMCAEKFCKYDDYNWDWTIMHLSLECLKRKLSVLVYKVPRMYHIGDCGLHHNKDC
ENSKATLIKVKGIINKNKEQMENNKVTLKESTFKALVPRLNGGWGDARDHQLCLSFMKNS
NVLI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgatttgtaaaagaagaatacgcaaggtgtttttaattttattccctgcacttcttgtg
gtttgttttatggtatatcttcaaaatgaaggaattttatacaacaatctagagaattat
tctgataaaaaagatgatagttcaatgaaattagatgttttaaaatcattaattgatatt
cagaaagatagtggagaagtaaagaaaataaatataccctttgaagatgatgctttatta
aaaaaatttctagatgaagcaaaaaagactaatgatccttttgctcaaagtgaaaactca
aattattttgattttttagactttaaaacagatttttcagacacaaaatatactgctagt
caattgcgctctgttattattgaactgaatgaaagacaacttgtatataacaatgataaa
ttctcaaaaagagaaaaagagttcgttgttattgttgttcaagttcataaaagaatagaa
tattttaaagaacttttagattcattgcagcgttcaaaaggtatagaaaatgcgatatta
gtcattagccatgatgtttatgctgacagtgtaaatgaactcattcgaaaaataactttt
tgccaggtgattcaaatcttttttccatattcaatgcagatgtacccaaatgagtatcct
ggccccagtgaaaatgattgtccaagagatatttcattatcagaagctcgtcgaattggt
tgtaataatgctgaaactccagatagttttggacattatcgtgaagcacatattacaatg
actaaacaccattggtggtggaaaatcaatatggtcatggatgtattagatgctaccaaa
aatcatgatggaccatttatgtttatagaggaggatcactatatggctccaagtttttat
gaatcacttatgaatcttcataagactaaaaaaagccatcctctatgtaagacttcatgt
gatattttgactattggttcatatgctatgaatgaagaaactcttaacaatgttgacgag
gcatatataggtgactggatatcaactcagcacaatatgggaatggctttgtatcgaagt
acatggaatgaaatcaaaatgtgcgctgagaaattttgcaaatatgatgattacaactgg
gattggaccatcatgcatcttagcttagaatgcttaaagagaaaactttcagttcttgtt
tataaagttccaagaatgtaccatattggtgattgcggtttacaccacaataaagattgt
gaaaattcaaaagccactttgataaaggtgaagggaataattaataaaaataaagaacaa
atggaaaataataaagtcacgttaaaagagtcaaccttcaaagctcttgtgccaagattg
aatggaggatggggtgatgctagagatcatcagttatgtttgagctttatgaaaaactca
aatgttttaatttag

DBGET integrated database retrieval system