KEGG   Hydra vulgaris: 100200273Help
Entry
100200273         CDS       T01080                                 

Definition
(RefSeq) delta-1-pyrroline-5-carboxylate synthase-like
  KO
K12657  delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
hmg  Hydra vulgaris
Pathway
hmg00330  Arginine and proline metabolism
hmg01100  Metabolic pathways
hmg01230  Biosynthesis of amino acids
Module
hmg_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100200273
Enzymes [BR:hmg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     100200273
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     100200273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase Aldedh
Motif
Other DBs
NCBI-GeneID: 100200273
NCBI-ProteinID: XP_002161058
Position
Un
AA seq 773 aa AA seqDB search
MLIRGIGLKKAYTNFCFYATRYASNVSNSGRYPPMQVIKSASPIHFRNQLKQCKRIVVKL
GSAVITRDDECGVALGRLASIVEQVSELQNAGKQMMIVTSGAVAFGKLKLRSELSMQQTM
RDSLRLNGRRGGLLDSRACAAVGQSGLVSLYEEMFNQYGVTVAQVLVTKPDFQNDRNREN
LQTTIEELIHMHCIPIVNANDVVAPQPSPDVDLSGIISLKDNDSLAAMFAVQMNADLLII
LSDVDGIYTGPPGEEGSSLLSVYRPSDKNLVRYSQVKSRVGTGGMESKVEAASFALDRGV
SVVIANGVFKDTTIITDILDGKKIGTFFTDAENEGPTSEEQALKARSCSRALQNLTPHQR
AEIIFRLSELLIERQAEILDVNQIDLNAAKKADNLSASMISRLALTPSKLKVLSEGLRQI
ANNSYDLLGRTLKATQVAEDLELRQITVPIGVVMVIFESRPDALPQVAALSIASGNGLLL
KGGKEASHTNKYLHSLVQEALQVHKTNGYVDAVALIDGRDEVADLLRMKDVVDLVIPRGS
SNMIASIKEMSKDIPVLGHAEGICHVYVDKEADIDMALKIVIDSKCDYPAACNAMETLLV
HENLLRTKAFDVLLDGLKNNGVTVHAGPRLCRALPFGPVPAKSLNVEYNQLECAMELVDG
VDDAVRHIHEYGSSHTDAIVTENKESAEKFLKNVDSACVFHNTSTRFADGYRFGLGAEVG
ISTGRIHARGPVGVEGLLTTKWVLRGKGHVVSDFSDSGKRKYLHQPKDVERDV
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgttgattagaggaatcgggttgaagaaagcttatacaaacttttgtttttatgccacc
agatatgcttcaaatgtatcaaacagcggaaggtatccacccatgcaagtaataaaatca
gcttcacctattcattttcgcaatcaactaaaacaatgtaaaagaattgttgtaaaactt
ggttctgctgtaattactcgagatgatgagtgtggtgtggctttggggcgtctagcttca
atagtggaacaggtatcagaattacagaatgctggaaagcagatgatgattgttacaagt
ggggctgttgcatttggtaaacttaaactgagaagtgagctgtcaatgcaacaaaccatg
cgtgattcacttagattaaatggaagacgtggaggtttattggattccagagcttgtgct
gcagttggacaaagtggtcttgtctctttatatgaggaaatgtttaatcagtatggtgtc
acagtagctcaggttctagtcacaaaaccagattttcaaaatgatcgtaaccgtgaaaat
ttgcagacaacaatcgaagagttaatacacatgcattgtataccaatagtaaatgcaaat
gatgttgttgctccacaacctagcccagatgtagatttatcagggataatcagtttaaaa
gacaacgacagcctggcagccatgtttgctgtgcaaatgaacgctgatctcttaatcatc
ctttcagatgttgatggtatttatacagggccaccaggtgaagaaggttcatctctgtta
agtgtctatcgtccaagtgataaaaatcttgttcgatatagtcaagtaaaatccagagta
ggtactggagggatggagtccaaggttgaagctgcatcatttgctcttgacagaggagtg
tctgttgttattgcaaatggcgtatttaaagatacaacaattattactgatatattagat
ggtaaaaaaattggaacctttttcacagatgctgaaaatgaaggaccaacatcagaggaa
caagctcttaaagcaagaagttgtagtcgggctttgcaaaatttgactcctcatcagcgt
gctgaaataatctttcgtctttccgaattacttatcgaaaggcaggcagaaatactagat
gtgaatcaaattgatcttaatgctgcaaaaaaggcagataatttaagtgcatctatgatt
tcacgacttgctttaacaccatcaaaacttaaagttttatctgaaggattgcgtcagatt
gctaataactcatatgatttacttggaagaacattaaaagccactcaagttgcagaagat
ctagagttgaggcaaataacagttcctataggtgttgtgatggttatatttgaatcaaga
cctgatgctctgcctcaggtagctgctctctcaatagctagtggtaatggattattgtta
aaaggtggtaaagaagcatctcatactaacaagtatttacattcacttgttcaagaagct
ctccaagttcataaaacgaatggatatgtagatgctgtcgctttgatcgatggtagagat
gaagtggcagatttgttgcgaatgaaagatgttgttgatttagttataccgcgtggttca
tcaaacatgattgcaagcattaaagagatgagtaaagatattccagttttaggtcacgca
gaaggaatttgccatgtttatgttgacaaagaagctgatattgatatggcactgaaaatt
gtcattgattcaaaatgtgattatcctgctgcttgcaatgctatggaaacattacttgtt
catgagaatttgttgcgaacaaaagcatttgatgtattgctagatgggctcaagaacaat
ggggtaactgttcatgctggtccacgtttatgcagagcactgccatttggtccagtacct
gctaaatcattaaatgtagaatacaatcaactagagtgtgccatggagcttgttgatgga
gttgatgatgctgtaaggcatatacatgaatatggaagctctcatacagatgctattgtg
actgaaaacaaagaatctgctgaaaagtttctaaaaaatgttgacagtgcatgtgttttt
cataatacaagtactcgttttgctgatggttatcgctttggtttaggtgcggaagttggt
attagcaccggtcgaattcatgctagaggaccagtaggtgtagaaggtttgttaacaaca
aaatgggtgttgagaggaaaaggacatgtagtaagtgatttttctgatagcggcaaacga
aagtatttgcatcaaccaaaagatgttgaacgtgatgtttaa

DBGET integrated database retrieval system