KEGG   Hydra vulgaris: 100201583Help
Entry
100201583         CDS       T01080                                 

Definition
(RefSeq) Fanconi anemia group D2 protein homolog
  KO
K10891  fanconi anemia group D2 protein
Organism
hmg  Hydra vulgaris
Pathway
hmg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100201583
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hmg03400]
    100201583
DNA repair and recombination proteins [BR:hmg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     100201583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2
Motif
Other DBs
NCBI-GeneID: 100201583
NCBI-ProteinID: XP_012562773
Position
Un
AA seq 318 aa AA seqDB search
MYKNMVRSSRRPQSLLSNSFQSDRKKQKISDLADNPLCVLVTKCGFIFSDNINQPNELGV
DQIMFQKDLSKALKNINEELKSNLINGLMDLWKDHKRFCFSLLPTISADICVNSSRGKQQ
ESFVRLLLGISYLQTPVAIALLEKLPEISIDEEMIKTAEELGDINLHQRMVDQLRWLDKI
YDSKVLVEKVFEIISISDVNAQREIILCVPDFMDESNHDEVVGNLHQLLCSNSQLTSSLM
EAFSCINLKTNLLEQVRDSAIKILDSADISNIAGIVKFLQQSLNDKSVHQIVAKIREKVD
FNSSSLRYTPAHRTKEEN
NT seq 956 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagaatatggtacgatcatcaaggcggccacagtctttactgtctaattcattt
caaagtgatagaaagaagcagaagatatctgatcttgctgataacccactttgtgtttta
gtcacaaaatgtggttttattttttccgataatattaatcaaccaaatgagctaggtgtc
gatcaaattatgtttcaaaaagatttatcgaaagctttaaagaatataaatgaagagtta
aagtctaatcttatcaatggccttatggatttgtggaaagaccacaaaagattttgcttt
agcttgttgcctacaatttcagcagatatatgtgtaaatagctctcgtggtaaacaacag
gaaagctttgttcgtttacttcttggaatttcttatttgcagactccggtagcaattgct
ttacttgaaaaattgcctgagataagcatagatgaggagatgataaagacagctgaggag
ctaggtgatattaaccttcatcaaagaatggttgaccaattgcgttggttagataaaata
tatgatagcaaggtacttgttgaaaaagtctttgaaataatatcaatctctgatgtaaat
gctcaacgtgaaattattttatgtgtgccagattttatggatgaaagcaaccatgatgaa
gtagttggtaatcttcaccaattgctatgcagtaactctcaattgacatcatctcttatg
gaagcatttagttgcattaacttaaagacaaatcttcttgaacaagttcgtgattcagct
ataaaaattttagattctgctgacatcagcaatattgcaggaattgtcaaatttttgcag
cagtctctaaatgataaaagtgttcatcaaattgttgctaagatacgtgaaaaagttgac
tttaactcatcaagcttaagatatactccagctcatagaacaaaagaagaaaacaa

DBGET integrated database retrieval system