KEGG   Hydra vulgaris: 100203097Help
Entry
100203097         CDS       T01080                                 

Definition
(RefSeq) endoplasmic reticulum resident protein 44-like
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
hmg  Hydra vulgaris
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hmg04131]
    100203097
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hmg04147]
    100203097
Membrane trafficking [BR:hmg04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100203097
Exosome [BR:hmg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100203097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Thioredoxin_2 Thioredoxin_7 Mating_N
Motif
Other DBs
NCBI-GeneID: 100203097
NCBI-ProteinID: XP_002155688
UniProt: T2M715
Position
Un
AA seq 439 aa AA seqDB search
MEKRNLNLFLSLFIVVLQIDTILTDALQLTQDNYQDVLSKNKLVFINFYADWCMFSQQLA
PIFHQTADIIHEEYPDVKFGRVDCENQQQIALENMISKYPTMKLFKNGKAMRKEYRGARS
VDAFTTFIKQNLKASVVDVNNKNDLHINEKKNTIVAYLEGKNDAYQNFNKIADEMNEIAD
FIAVLGDASAQERHMGETIIFKPKKTSGESEAALTVALNNYEQLKQWVSDKANPLVREIT
FENGEELTEEGLPFLILFHKPDDIISIQRFKNAVARELLSERGRVNFLTADGTTFAHPLH
HLGKSIHDLPLIAIDSFRHMYMFKRFDNIDVSGKLKQFINDLHSGKLHQDFHNPPPDTVV
ETPNEAVEVHQEVPKEATQEGGDIQTKYDPASQEKKTEGGSGSGQAPPPETVFNKLAPSE
NRYTLLHWRDYSGEWRDEL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaagaaatttaaacctttttttaagtctttttatagtagtattgcaaattgat
accattttgactgatgccttacagttaacgcaagataactatcaggatgttttatcaaaa
aataaacttgttttcataaatttctatgccgattggtgtatgtttagccaacaattggct
cctatatttcatcaaactgcagatatcattcatgaagagtatccagatgtaaagtttggt
cgtgttgattgcgaaaaccaacaacaaatagcacttgaaaatatgatcagtaaatatccc
acaatgaagttgttcaaaaatggcaaagcaatgcgaaaagaatatcgcggcgcacgttca
gttgatgcattcacaacatttataaaacaaaatttaaaagcatctgtagttgatgtcaac
aataaaaatgatctgcacattaatgagaaaaagaataccattgttgcttatcttgaagga
aaaaatgatgcatatcagaattttaataagattgcagatgagatgaatgaaatagctgat
tttattgctgtcttaggagatgcaagtgctcaggagcgtcatatgggagaaactattata
tttaagcccaagaagacttctggtgaatcagaggctgctcttacagttgctttaaataat
tacgaacaacttaaacaatgggttagtgacaaagctaatccattagtaagagaaataaca
tttgaaaatggagaagagctcactgaagaaggtctgccatttttaattctttttcataag
cctgacgatatcataagcattcaaagattcaaaaatgctgtagcaagagaacttttatca
gaaagaggacgtgtaaattttttaactgcagatggtacaacatttgctcatccattacat
catcttggaaaatcaattcatgatttaccgttaattgctattgatagtttcagacacatg
tatatgttcaagagatttgataacatagatgtatcaggtaagttgaagcagtttataaat
gatcttcattcaggaaagttgcaccaagactttcataatccacctcctgacactgttgtt
gagacaccaaatgaagctgtcgaagttcatcaagaggtaccaaaagaagcaacgcaagaa
ggaggtgatatacaaacaaaatatgatccagcttctcaagaaaagaaaaccgaaggcgga
tcaggatctggtcaagcacctcctcccgagacagtgttcaataaacttgcaccatcagaa
aacagatatacgcttttacattggcgagattattctggagaatggcgtgatgaactgtaa

DBGET integrated database retrieval system