KEGG   Hydra vulgaris: 100204042
Entry
100204042         CDS       T01080                                 

Definition
(RefSeq) doublesex- and mab-3-related transcription factor A2-like
  KO
K19491  doublesex- and mab-3-related transcription factor 4/5
Organism
hmg  Hydra vulgaris
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hmg03000]
    100204042
Transcription factors [BR:hmg03000]
 Eukaryotic type
  Other transcription factors
   DMRT
    100204042
SSDB
Motif
Pfam: DM DMA HECT zf-C3HC
Other DBs
NCBI-GeneID: 100204042
NCBI-ProteinID: XP_002158720
UniProt: T2M6E8
Position
Un
AA seq 435 aa
MIAVSSHNKVPPRLPKCARCRNHGVVSILKGHKRFCRWRDCNCPDCNLIAERQRVMAAQV
ALRRQQDQEEYMRAVQLQQSDDPSPAISQPVSTTPLNGVIKGPTLSVAQTWSLNEPVVMS
EIAIGDAKCHEFKKEETYNSDDDYAIGNVADDSPECEDKNEKSETCDEQASPKRKLSSVI
ENHNIMPLVSPRLQSSSSSENEEPVVKIARIEPEMSVHQKQLQQKNLDLLSRLYPEQKRG
VLELILKGCNNDIVQAIECILPSHERAIQQLSMLPNQSYSLNGSTKTIETLTRTYPHITG
EKISSAFLPFTTNQHSIPVQSFSATITSGGCPPGCMCQKQQKCECVDCLNGKTNHMPNNH
TSTNSLKYPIQTLSHLNHIAPNKLKTAHRMAPYVPVSSHVGNTLSEPVKICAGCGGTMKL
EDQRCPNCEPEPIKT
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgatagccgtttcaagccataacaaagtcccaccaaggcttccaaaatgtgcgaggtgc
aggaatcacggtgtcgtctcaatacttaaagggcacaaacgattttgccgatggcgtgac
tgcaattgcccagattgcaacttgattgctgagcgccaaagggtcatggcggcacaagta
gcattgcgacgtcaacaagaccaagaagaatacatgagagcagttcaattgcaacaaagt
gatgatccatctccggcaatttctcaacctgtctctactaccccattaaacggtgttatt
aaaggtcctactttatccgtagcgcaaacttggagtttgaacgagccagttgtcatgtca
gaaatcgcaataggtgatgcaaaatgccacgagttcaaaaaagaagaaacttataattca
gacgacgattacgctattggaaacgttgcggacgattcaccggaatgtgaagacaaaaac
gaaaagtcagaaacttgtgatgaacaggcatcaccaaagcgaaagttatcatctgttata
gaaaatcacaacataatgccattagtgtcaccacggcttcagtcatcttcatcttcagag
aacgaagaacctgttgtaaaaattgctcgaattgaaccagaaatgtcagttcatcagaag
cagctacaacaaaaaaacctagatttgttatctcgcctatatcctgagcaaaaaagagga
gttcttgaactaattttaaaaggttgtaataacgatattgtgcaagcaatcgagtgcatt
ttaccaagtcacgaaagagctatacaacagttatctatgttaccgaaccaaagttattct
ctaaatggtagcacaaaaaccattgaaacacttacccgaacctaccctcatatcacaggt
gaaaaaatttcgtcagcattcttgccttttactactaatcaacactcgatacctgttcag
tctttttctgctactataacctctggtggttgccctcctgggtgtatgtgccagaaacag
caaaagtgtgaatgcgttgactgtttaaacggaaaaacaaatcatatgcctaataatcac
acttctacgaactcactaaaatatcccattcaaacattatctcatttaaaccatattgct
cctaacaaattaaaaactgcccatagaatggcgccatacgttccggtatcatcgcatgta
ggaaatacgttatcagagccagttaaaatatgtgctggatgtggtggaactatgaaactc
gaagaccagagatgccctaattgcgagccggagccaattaagacttga

DBGET integrated database retrieval system