KEGG   Hydra vulgaris: 100204193Help
Entry
100204193         CDS       T01080                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase-like
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
hmg  Hydra vulgaris
Pathway
hmg00030  Pentose phosphate pathway
hmg00480  Glutathione metabolism
hmg01100  Metabolic pathways
hmg01200  Carbon metabolism
Module
hmg_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
hmg_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100204193
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100204193
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hmg04147]
    100204193
Enzymes [BR:hmg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     100204193
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     100204193
Exosome [BR:hmg04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100204193
  Exosomal proteins of colorectal cancer cells
   100204193
  Exosomal proteins of bladder cancer cells
   100204193
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 100204193
NCBI-ProteinID: XP_012560614
Position
Un
AA seq 306 aa AA seqDB search
ELYRHDWLPTHTNFVGYARSKLSVADIRSQAEPFMKVNDDQRSKLEEFFHVNYYFSGSYT
EADDFIKLDEEIGKLEEAEHIEKSDRIFYLALPPSVFIVVTQMIKDYCQSKSGWTRIVVE
KPFGKDSESSSVLSKHLSMCFKEEQIYRIDHYLGKEMVQNIMVLRFANRIFGPVWNRDNI
QCVHITFKEDIGTYRRGGYYDEYGVIRDIMQNHIMQVLCLTAMEKPASKNADDIRDEKVK
VLKSIKPLSLNDIVFGQYIGNPDCSLADSKFGYLDDATVPSESRTPTFACAVLYICNERW
DGIFLL
NT seq 919 nt NT seq  +upstreamnt  +downstreamnt
ggaattatatcgtcatgattggttacccacacatacaaactttgtgggttatgcgcgttc
aaagttatctgtagccgatattcgtagtcaagctgagccatttatgaaggtaaacgatga
tcagcgatccaagttagaagaattttttcatgttaattactatttctctggttcttatac
tgaagctgatgattttattaaattagatgaagaaattggaaagttagaagaggctgaaca
tattgagaaatcagacagaattttctacttagcattgccaccatctgtattcatagttgt
tacacaaatgatcaaagattattgtcaaagcaaaagtggatggactcgtattgtagttga
aaaaccctttggtaaagattctgaatcatcatcagtactttcaaaacacttatcaatgtg
ctttaaagaagaacaaatatatagaattgatcattatttaggtaaagagatggtccagaa
tataatggtgctaaggtttgcaaatagaatctttggtcctgtttggaatcgggacaatat
tcaatgtgttcatatcacttttaaagaagatattggtacatataggcgagggggttacta
tgatgaatatggagttattagagacattatgcagaatcatattatgcaagtactgtgtct
tacagcaatggaaaagcctgcttccaaaaatgctgatgatataagagatgaaaaagtaaa
agttttaaaatccatcaaacctctttctcttaatgacattgtatttggtcaatatattgg
taaccctgattgctctttagcggattcaaagtttggttatcttgatgatgcaactgttcc
cagtgaatctaggacacctacatttgcatgtgcagttttgtatatttgtaatgaaagatg
ggatggtatatttttactt

DBGET integrated database retrieval system