KEGG   Hydra vulgaris: 100204238Help
Entry
100204238         CDS       T01080                                 

Gene name
parp1
Definition
(RefSeq) poly [ADP-ribose] polymerase 1
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
hmg  Hydra vulgaris
Pathway
hmg03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    100204238 (parp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hmg03032]
    100204238 (parp1)
   03036 Chromosome and associated proteins [BR:hmg03036]
    100204238 (parp1)
   03400 DNA repair and recombination proteins [BR:hmg03400]
    100204238 (parp1)
Enzymes [BR:hmg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     100204238 (parp1)
DNA replication proteins [BR:hmg03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     100204238 (parp1)
Chromosome and associated proteins [BR:hmg03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    100204238 (parp1)
DNA repair and recombination proteins [BR:hmg03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     100204238 (parp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg
Motif
Other DBs
NCBI-GeneID: 100204238
NCBI-ProteinID: XP_002163577
Position
Un
AA seq 398 aa AA seqDB search
MPDMLASQRNTWSNRKDFVKYPNKFYPLDIDYGQNDEMLQSSITPGSLSILPNPVKELIK
LIFDVEAMKHALVEFEIDMKKMPLGKLSKKQIETAYGCLGDCQKFLANNDPGSKILDASN
RFYTLIPHDFGMKKPPLLDNEELIKLKIGMLDSLMEIEVAYNLIKGTKDNGAKDPIDLHY
ETLKTDIKVVDKESKDFELIVEYVKNTHAKTHSNYSLDVIEVFSIERAGEKQRYRPFKDL
FNKKLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGIYFADMASKSANYCCTTRSN
NTGLMLLCEVALGNMYELKQSEHISKLPPGKHSCKGLGSTSPDPSMDKVIDGEVLVPLGK
PISTNIKDSTLLYNEYIVYDVAQVNIKYLVQLKFNYCY
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgccagatatgcttgcttcacaaagaaacacctggagcaatcgaaaagattttgtaaag
tatccaaacaagttttatccccttgatattgattatggccagaatgatgaaatgttgcaa
agctctattactccaggtagtttaagtattttaccgaatccagtaaaagaacttataaaa
cttatcttcgatgtagaagcaatgaaacatgctcttgtagaatttgaaatagacatgaaa
aaaatgcctcttggtaaattatcaaaaaaacaaattgaaacagcatatggttgtcttgga
gattgtcaaaaattcttagctaataatgatccaggatcaaaaatccttgatgcttcaaat
cgattttatacattaatacctcatgattttgggatgaaaaaaccaccactgttagataat
gaagagttaataaaacttaaaattgggatgcttgatagtttgatggaaatagaagttgca
tacaatttgataaaaggtacaaaagataatggagcaaaagatcctatagacctccattat
gaaactttaaaaacagatattaaggttgttgataaagaaagtaaagatttcgaattaatt
gtagagtatgtaaaaaatacccatgcaaaaactcactctaactattctcttgatgtaata
gaggttttctcgattgagcgtgctggcgaaaagcaaaggtatcgaccattcaaagattta
tttaacaaaaagttactttggcatggttcacgaactactaattatgctggcattctgtct
caaggcttgcgtattgctcctcctgaagctcctgtaacgggttatatgtttggaaaagga
atttattttgcagatatggcttccaagtctgcaaattattgttgtacaactcgttcaaac
aatacagggttaatgttgctatgtgaggtagcactcggaaatatgtatgagcttaagcaa
tctgagcatatttcaaaattaccacctggcaagcatagttgtaaaggattaggaagtacg
agtcctgatccctcaatggataaagtgatagacggtgaagttctagttcccctaggtaaa
cccataagcacaaacataaaagattctacacttctgtacaacgagtatatagtgtacgat
gttgcgcaagtaaatataaagtatttagttcagttaaagtttaactattgttattga

DBGET integrated database retrieval system