KEGG   Hydra vulgaris: 100205480Help
Entry
100205480         CDS       T01080                                 

Definition
(RefSeq) cyclin-dependent kinase 10-like
  KO
K02449  cyclin-dependent kinase 10 [EC:2.7.11.22]
Organism
hmg  Hydra vulgaris
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hmg01001]
    100205480
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100205480
Protein kinases [BR:hmg01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100205480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 100205480
NCBI-ProteinID: XP_012558761
UniProt: T2MDH9
Position
Un
AA seq 390 aa AA seqDB search
MTTENDDNYIEKVVLYSFKNPCEPVECPNLPFIGSCRSVAEFQKLNRVGEGTYGVVYRAK
DSSTGQIVALKRVRMDKEKEGLPISSLREINLLMRIKHKNIVKLKEVVVGRPLEYIFLVM
EYCEHDLAGLLDNMLTPFTESQVKCLLIQLLLGTEYLHNNFIIHRDIKMSNLLMTNNGTL
KIADFGLARTFGKSGKLMTPVVVTLWYRSPELLLGSRLHSPKVDIWAIGCVMGELLLCKP
LMPGKSEINQMQLIIDLLGSPNEKIWPGFVNLPGAKNFQFKHQPYNNVKQRFPWLSSSGV
SLMNSMFTFDPEQRISAQDCLESSYFKDKPLPIEKSLMPTFPEHRNFRGIWKEEKAGVSE
VSKNKYECKIKTKVTKKLAQHLKSKNSYKR
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgactactgaaaatgatgataattatattgaaaaggttgttttgtattcatttaaaaat
ccatgtgagccagttgaatgtcccaatcttcctttcataggaagttgtcgcagtgtagct
gaatttcagaagttaaatagagttggtgagggtacctatggagtagtttatcgtgctaaa
gactcaagcacaggacaaattgttgcgctaaaacgagttcgaatggataaagaaaaggaa
ggtctccctatcagtagtttacgtgagataaatttgttaatgagaatcaaacataaaaac
attgtcaagcttaaagaagttgttgttggaagacctttggaatatatttttttagtaatg
gagtactgtgaacatgatttagcagggttactagataatatgttgactccatttacagaa
tctcaagtcaaatgcttgcttattcagcttttacttggtactgaataccttcacaacaac
tttattattcatagagatattaaaatgtcaaatcttttaatgacaaacaatggaacttta
aaaatagcggattttggattagcacgaacatttggtaagtcgggtaagttaatgacacct
gtagtggtgaccctttggtatcgaagtccagagcttttactaggttcacgactccattca
cctaaggtagatatatgggctattggttgtgtcatgggtgaacttctattgtgcaagcct
ctgatgccaggaaaatctgagataaatcaaatgcaacttattattgatttacttggttca
ccaaatgaaaaaatatggcctggttttgtcaatcttccaggtgcaaaaaattttcagttc
aaacaccagccttacaacaatgtcaagcagcgctttccttggctatccagttctggagtt
tctctgatgaatagcatgtttacatttgatccagaacaacgtatatctgcccaagactgt
ctagaaagctcttattttaaagataagcccctacctattgagaaatcacttatgccaaca
tttcctgaacacagaaattttcgcggtatttggaaagaagaaaaagcaggagtatcagag
gtatccaaaaacaaatacgaatgtaaaataaaaactaaagttacaaaaaaacttgctcag
catttgaaatctaaaaactcttataagagatag

DBGET integrated database retrieval system