KEGG   Hydra vulgaris: 100206393Help
Entry
100206393         CDS       T01080                                 

Definition
(RefSeq) triosephosphate isomerase-like
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hmg  Hydra vulgaris
Pathway
hmg00010  Glycolysis / Gluconeogenesis
hmg00051  Fructose and mannose metabolism
hmg00562  Inositol phosphate metabolism
hmg01100  Metabolic pathways
hmg01200  Carbon metabolism
hmg01230  Biosynthesis of amino acids
Module
hmg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hmg_M00002  Glycolysis, core module involving three-carbon compounds
hmg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100206393
   00051 Fructose and mannose metabolism
    100206393
   00562 Inositol phosphate metabolism
    100206393
Enzymes [BR:hmg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100206393
Exosome [BR:hmg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100206393
  Exosomal proteins of bladder cancer cells
   100206393
  Exosomal proteins of melanoma cells
   100206393
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM DUF2192
Motif
Other DBs
NCBI-GeneID: 100206393
NCBI-ProteinID: XP_002167611
UniProt: T2MEH2
Position
Un
AA seq 249 aa AA seqDB search
MSCRKFFVGGNWKMNGDKAKILSILELLNSSNLSSKTEVVVAPPSIYVSYVKDHIKPEVS
VSLQNCHEATSGAFTGEISAEMGQDVGCKWVILGHSERRNVFGETNSVIGEKIKHVLKST
NLNIIACIGELLDEREAGKTLEVCATQMKAIASNVSDWSRIVIAYEPVWAIGTGKVATPS
QAQEVHLDVRKWLALNVSEDVAQATRILYGGSVTGTNCAELALKEDVDGFLVGGASLKPE
FIDIINAGK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtcgcaaattttttgttggtggaaattggaaaatgaatggtgataaagcaaaa
attttaagcattttggaacttcttaattcaagtaatctaagttctaaaactgaagttgtt
gttgccccgccttcaatttatgtatcctatgtaaaagatcatatcaagcctgaagttagt
gtttctctgcaaaactgtcatgaagcaacatcaggggcatttactggtgaaatctctgct
gaaatgggtcaagatgttggctgtaagtgggttatcttaggtcattcagagcgcagaaat
gtttttggagaaacaaattctgttattggggagaaaataaaacatgttttaaaatctacc
aacttaaacatcattgcttgcattggtgaacttcttgatgagagagaggcaggaaaaaca
ctagaagtatgtgctacccaaatgaaagcaatagcctccaatgtaagtgattggtctcgg
attgtaattgcatatgaacctgtatgggcaataggcacaggaaaagtagctactccaagt
caggcacaagaagttcatcttgatgtaagaaaatggttggctttaaatgttagcgaagat
gttgctcaagctacaagaatcttatatggagggtcagttactggcacaaattgtgctgag
ttagccttgaaggaagatgttgatggttttttagttggtggagcttctcttaaaccagaa
tttattgacattattaatgcaggaaaatga

DBGET integrated database retrieval system