KEGG   Hydra vulgaris: 100206733Help
Entry
100206733         CDS       T01080                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase beta-like
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
hmg  Hydra vulgaris
Pathway
hmg00051  Fructose and mannose metabolism
hmg00520  Amino sugar and nucleotide sugar metabolism
hmg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    100206733
   00520 Amino sugar and nucleotide sugar metabolism
    100206733
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     100206733
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 100206733
NCBI-ProteinID: XP_002169917
Position
Un
AA seq 134 aa AA seqDB search
MNALILVGGYGTRLRPLTLSRPKPLIEFCNKPMLLHQVEALAKAGVKHVILAVSYLSDML
EEELKKEEEKLGIKISMSHEREPLGTAGPLALARHWLEESTEPFFVLNSDITCEYPFEEM
INFHKKHGKEGTLV
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctcttattttggttggtggatatggaacaagattgaggccactaactttatca
agaccgaaacctttaattgagttttgtaataaaccaatgcttttgcaccaagttgaagca
ttggcaaaggctggggttaagcatgtaatccttgctgtcagctatctatcagatatgctt
gaagaagaactcaaaaaagaggaagaaaagcttgggattaagataagtatgtcacatgaa
cgggaacccttgggaacagctggtccgttagcgcttgctaggcattggcttgaagaatca
acagaacccttttttgttttaaatagtgacataacatgtgaatacccttttgaagagatg
attaattttcataagaagcatggcaaagaaggaacactagtt

DBGET integrated database retrieval system