KEGG   Hydra vulgaris: 100208165Help
Entry
100208165         CDS       T01080                                 

Definition
(RefSeq) phosphomannomutase-like
  KO
K17497  phosphomannomutase [EC:5.4.2.8]
Organism
hmg  Hydra vulgaris
Pathway
hmg00051  Fructose and mannose metabolism
hmg00520  Amino sugar and nucleotide sugar metabolism
hmg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    100208165
   00520 Amino sugar and nucleotide sugar metabolism
    100208165
Enzymes [BR:hmg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     100208165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMM Hydrolase_3 Hydrolase
Motif
Other DBs
NCBI-GeneID: 100208165
NCBI-ProteinID: XP_002167689
Position
Un
AA seq 247 aa AA seqDB search
MSKNEEIVCLFDVDGTLTESRKKISDEMHKFMLQLTKKVVVGLVGGSDLEKIKEQMGGER
CMTDFDYVFAENGLVAYKGGELIYVQSFLKHYGEEKSQEIINFCLEYMSKLTLPCKRGTF
IEYRNGLINVCPVGRSCSQEERTQFNKYDQEHLIRKKFAEAVEEKFSAYDLQCTIGGEIS
FDVFPIGWDKRCCLQHLDMTKIKEIHFFGDKVHKGGNDHEIYTDERVIGHQVANPNDTME
QLRCLFF
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaatgaagaaatagtatgtttgtttgatgttgatggaaccttgactgaatct
agaaaaaaaatatcagatgaaatgcacaaatttatgttacaattaaccaaaaaagttgtt
gttggattggtaggtggatcagatctggaaaagataaaagagcagatgggaggagaaaga
tgcatgacagattttgattatgtttttgctgaaaatggcttagtcgcttataaaggtggt
gaattaatatatgttcaaagttttctcaagcattatggcgaagaaaaatctcaggagatt
atcaacttttgtttagaatatatgtcaaaattgaccctgccatgtaaaagaggtacgttt
attgagtacagaaatggacttattaatgtgtgtccggttggaagaagttgttctcaagaa
gaaagaactcagtttaataaatatgaccaggagcatttgattagaaaaaagtttgcagaa
gcagtagaagaaaaattttctgcttatgaccttcaatgcacaattggtggtgaaataagt
tttgatgtgtttcctattggttgggacaagcgctgttgtttgcagcatttagacatgact
aaaatcaaagaaattcatttttttggtgataaggttcataaaggaggcaatgatcatgaa
atatatacagacgaacgtgttattggtcaccaagtagcaaatcctaatgatacaatggag
cagttaagatgcttgtttttctaa

DBGET integrated database retrieval system