KEGG   Hydra vulgaris: 100209230Help
Entry
100209230         CDS       T01080                                 

Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-like
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
hmg  Hydra vulgaris
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hmg04147]
    100209230
Enzymes [BR:hmg01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     100209230
Exosome [BR:hmg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100209230
  Exosomal proteins of other body fluids (saliva and urine)
   100209230
  Exosomal proteins of colorectal cancer cells
   100209230
  Exosomal proteins of bladder cancer cells
   100209230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 HAD Isochorismatase
Motif
Other DBs
NCBI-GeneID: 100209230
NCBI-ProteinID: XP_012558986
Position
Un
AA seq 805 aa AA seqDB search
MDDLKKELEMDEHKIDIKDLLIRLETSVEKGLSSSVAARNLDRDGLNTLQGIKGTPEWIK
FGRQMISGFALLLWAGALLCYIVTIIRFTTEPNPVYDEVYLGTVLVVVVVLTGIFSYYQV
CLTLTAKKMAKKNCLVKNLQAVETLGSTSVICSDKTGTLTQNRMTVAHIWFDLHAVEINT
TENQSPFNEQQNSPTWEALARIGALCSRADFKSGQENVPIMRKDCTGDASEVAILKFIEN
TVGDVMSIRSKNKKLAEVPFNSATKFQVSVHKLENANSSPDASIYIAVMKGAPERILERC
AYALIDGKVQPINEEFIETFNKAYATLGGFGERVLGFCHCYLPQDQYPDGFAFDSEETNF
QLDKYCFVGLMSMLDPPRPSVPDAVSRCRSAGIKVIMVTGDHPITAKAIARSVGIISEGT
ETIEDIAQRLNIPIEQVQKNHAKACVVSGSQLKDMSQKDLDDVLKNHTEIVFARTSPQQK
LIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFSSI
VTGVEEGRLIFDNLKKTIVYMLTCNIAELTPFVFFIILNIPLPLGNIPMLLISIGTDIAP
AIALAYEPSENDIMERKPRDPKRDNLVNARLICQSYAVRGVIESVGAFLCYFIVLGQNGF
WPLDLIGIRKSWDDNTNNNLPDSYGSEWTYYQRKELELTVHTAFFTTIVVCQWGDLIASK
TRRLSLFQHGMKNWVIFFAIFFETTLTCFAQYTPGLNTALTLRPIRFVYWLPGLPYALFL
FVFDEIRKYFISHYPGGFFERETAY
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atggatgatctcaaaaaagagcttgaaatggatgaacataaaattgacataaaggatttg
ctaataaggctggaaacaagtgtagagaaagggctgagttcaagtgttgctgctagaaat
ttagatcgtgatggcttaaatactcttcaaggtattaaaggcacacctgagtggatcaaa
tttggaaggcaaatgataagtggttttgcattgcttttgtgggctggtgctttactatgt
tatattgtcaccattattcgatttacaactgaaccaaatccagtatatgacgaagtttac
ttgggcactgttttggtagttgttgttgttttaactggcattttttcttattatcaggtt
tgcctaaccttaacagcaaaaaaaatggctaaaaaaaattgtttagttaaaaacttacaa
gctgttgaaacacttggaagtacttcagttatttgttcagataaaactgggacattaaca
caaaaccgaatgacagtggcgcatatctggtttgatttgcatgctgttgaaataaataca
acagaaaatcaatctccttttaatgaacaacaaaactcaccaacatgggaagcacttgca
agaattggtgcattatgtagtagagctgattttaaaagtggtcaagaaaatgttccaata
atgagaaaagattgtacaggtgatgcatcagaggtagccattttaaagtttattgaaaat
actgttggagatgttatgagcatacgctcaaaaaataaaaaacttgcagaggttcctttt
aactcagctactaagtttcaggtgtctgttcataagttagaaaatgcaaattcttctcct
gatgcatcaatatatattgctgttatgaaaggtgcacctgaaagaatcttggaaagatgc
gcgtatgctttaattgatggaaaagtacaaccaatcaatgaagaatttattgaaacattt
aacaaagcttatgccactcttggtggttttggtgagcgcgtattaggtttttgtcattgc
tatcttcctcaagatcaatatcctgatggttttgcatttgattctgaggaaactaacttt
caacttgataaatattgttttgtgggattgatgagtatgttagatccccccagaccttct
gtgccagatgctgttagtagatgtagaagtgctggtatcaaagtcatcatggtaaccggt
gaccatcctattacagcaaaagctatagctagaagtgttggaattatatctgaaggaact
gagactattgaagacatagcacaaaggttaaatataccaattgaacaagtccaaaaaaat
catgcaaaagcatgtgtagtaagtggaagtcagttaaaagacatgagtcaaaaagatctt
gatgatgttttgaaaaatcatactgagattgtttttgctcgcacatcacctcagcaaaaa
ctgatcattgtagaaggttgtcaacgtcaaggtgcaattgtagctgttactggtgatggt
gtaaatgattcaccggccttaaagaaggctgacattggtattgcaatgggtatagcagga
tccgatgtatctaagcaagctgctgatatgattctgctagatgataatttttcttccatt
gtaactggtgttgaagaaggacgtttgatatttgataatttaaagaagacaattgtgtac
atgctaacctgtaacatagctgaattaacaccctttgttttttttattatattaaatatt
ccactgcctctcggaaatattccaatgttattaatctctattggtactgacattgcacca
gccattgcattagcttatgaaccatcagaaaatgatatcatggaaagaaaacctcgagat
cctaagcgtgataaccttgtcaatgctcgtcttatatgtcaatcttacgctgtcagaggt
gtaattgagtctgttggcgcttttttgtgttactttattgttctgggtcaaaatggattt
tggcctttagatttaataggaattagaaaatcatgggatgataatactaataataatctt
ccagattcttatgggagtgaatggacttattaccaaaggaaagagttagaattaacagtc
catacagcttttttcactactattgttgtttgtcaatggggtgatcttattgccagtaaa
actcgtcggttgtctctatttcagcatggaatgaaaaactgggttatattctttgcaata
ttttttgagacaactttaacttgttttgctcagtatacacctgggttaaatactgctttg
accttgcgtccaattagatttgtttattggctgcctggtctaccgtatgctttattctta
tttgtttttgacgagatacggaaatattttatttcccactatccaggaggtttttttgaa
agggaaacggcttattag

DBGET integrated database retrieval system