KEGG   Hydra vulgaris: 100210639Help
Entry
100210639         CDS       T01080                                 

Definition
(RefSeq) probable NADH dehydrogenase
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
hmg  Hydra vulgaris
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100210639
Enzymes [BR:hmg01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     100210639
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 DPCD
Motif
Other DBs
NCBI-GeneID: 100210639
NCBI-ProteinID: XP_002156851
Position
Un
AA seq 422 aa AA seqDB search
MPFSLSSVLYRKRLVLLGTGWGCYSVLKNINKKLYDVIVVSPRNHFLFTPLLNSTTVGTL
EFRSIIEPIRNTKFRDDHHFQLAEAIHLNPHDKLVVCKAVSSDKEYTLSYDKVVIGVGAV
SNTFGIPGVPKYAYFLKEIADARKIRNQIISNFEQSLFPYVNEEERLSLLHFVIVGGGPT
GIEFGAELYDFITHDVARLFPGEKNDVHVTLVEGDSILPSFDQRLRKFAERKITQRENFH
LIKDFVVEVGENYVKLKSGKVLLTKLVVWSTGLGPRKFIESLDLPKGKSKQLKVDDHLRV
VGYDSIFAIGDCSYIDGSPLPSTAQVAERQGRYVAQYLSLLETNSKTDSKPFMWSNAGML
AYIGGYKAVADLPTKAGKITGFKSWLIWRSVYLTRLGSWRNRMQVPFDWARTFFFGRDIS
RF
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgccattctctttatcatctgttctgtatcggaaaagacttgttttattaggaacagga
tggggatgttatagtgtgttaaaaaatattaacaagaagctttatgatgtgattgttgtt
agtccacgaaatcattttctttttacacccttgttaaatagcacaactgttgggacttta
gaatttcgaagcataattgaaccgattcgaaacactaagtttcgggatgatcatcatttt
caattggctgaagcaattcacttaaatccacatgataaattagttgtttgtaaagcagtc
tcatctgataaagaatatactttatcatacgataaagttgtaattggtgttggagctgtt
agtaatacttttggaattcctggtgtcccaaagtatgcatattttttgaaagaaatagca
gatgctagaaaaatacgtaatcaaatcatatctaattttgagcaaagtttgtttccatat
gtaaatgaagaggaaaggttatcactgttgcattttgtcattgttggtggtggtccaact
ggtattgaatttggagctgagttgtatgactttataacacatgatgttgcaagacttttt
ccaggagagaagaatgatgttcatgtaacattagttgaaggagattcaatattaccttca
tttgaccagcgattacgtaaatttgctgagagaaaaattacacaaagagaaaatttccac
ttaatcaaagattttgttgtggaagttggtgaaaactatgtgaagttgaaatcaggaaaa
gttcttttaactaagcttgtagtgtggtcaaccggtcttggtcccagaaagtttatagaa
agtttagacctacctaaaggtaaatcaaaacaactcaaggtagatgatcatcttcgtgta
gttggttatgacagtatatttgcaattggtgattgttcatacatagatggatctccttta
ccaagcacggctcaagtggctgaaagacaaggtcgatatgttgcacagtacttatcctta
ttagaaacaaattctaaaacagacagtaaaccatttatgtggtccaatgctggtatgctt
gcatatattggtggatataaagctgttgcagatcttccaacaaaagctgggaagataact
ggatttaaaagttggttaatatggcgatcggtttatcttactcgcttagggagctggaga
aatcgaatgcaagttccatttgactgggctaggacttttttttttggcagggatatatct
aggttttaa

DBGET integrated database retrieval system