KEGG   Hydra vulgaris: 100212701Help
Entry
100212701         CDS       T01080                                 

Definition
(RefSeq) annexin A4-like
  KO
K17095  annexin A7/11
Organism
hmg  Hydra vulgaris
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hmg04147]
    100212701
Exosome [BR:hmg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100212701
  Exosomal proteins of other body fluids (saliva and urine)
   100212701
  Exosomal proteins of colorectal cancer cells
   100212701
  Exosomal proteins of bladder cancer cells
   100212701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin
Motif
Other DBs
NCBI-GeneID: 100212701
NCBI-ProteinID: XP_012553809
Position
Un
AA seq 594 aa AA seqDB search
MAYPPPGGGYGYPTGYPPANIAYPPADVGAYPTIPGYIPPGGPAYPTSFPPYGGYDQPPL
QPGFSPMTPQGDFHHHHQQPYAQQNYSGFAPPHSYGPPGQQYVPPPQTYGQQPAYGQQPA
YGQQLPYGQQPVQSQQPAYGQQPPQGQQPVYGQQPPQSQQPPYGQQPVQGQQPPYGQQPP
QGQPPYGQQPPGQQPTYGQQPPQGQQPPYGQQPPQGQQPPYGQPAPQVQQPPCGQQPPQV
QQPPQQAQVAPPTNPLPSGTPAAQPPYSQMSNMAISAPTRGTIFPKSPFDAETDCELLRK
AMRGVGTDEDALINILVAPCNRQRVEIRLRYKTMFGKDLMNDLKSELSGNLEETLLALLE
PTVLYDAKCLRKAMAGAGTDESTLIDILCSRTNSQIKEIKQEYSNYFKRDLEKDCVSETS
GHFKRLLVSMCQGNRDETGVVDLEKAKKEAAELYQAGEKKWGTDESRFNVILASRNFNQL
KATFDEYVKISQRDILNTIDREMSGDLKDGFKCIIQCARNPAEYFADRLWHSMKGMGTND
SLLIRIIVSRSEVDLADIKTAFLRKYQKTLYKMIEGDCSGDYKKLLLAIVKPDI
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcttatccaccacctggcggtggttatggttaccctactggttaccctccagcaaac
attgcttatccaccagccgatgttggagcatacccaaccataccaggttacattccacca
ggaggtccagcttatcctacttcattcccgccttatggtggatatgatcaaccacctcta
caacctggattttctccaatgacacctcaaggagactttcaccatcatcatcaacaacca
tatgctcaacaaaactactctggttttgctccacctcattcttatggtccacctggtcag
caatatgtcccacctccacaaacctatggacaacaaccagcatatggacaacaaccagca
tatggtcaacaactcccatatgggcaacaaccagtacaaagtcaacaaccagcatatggt
cagcaaccacctcaaggtcaacaaccagtatatggtcagcaaccacctcaaagccaacaa
ccaccatatggtcagcaaccagttcaaggccaacaaccaccatatggtcagcaaccacct
caaggccaaccaccatatgggcaacagccacctggtcagcagccaacatatgggcaacaa
ccacctcaaggtcagcaacctccatatggccaacaaccacctcaaggtcaacagcctcca
tatgggcaaccagctcctcaggttcagcaacctccatgtgggcaacaaccgcctcaagtt
caacagcctcctcagcaagctcaagttgctcccccaactaaccctctaccatctggaact
ccggcagctcagcctccttattctcagatgtcaaatatggctataagtgcacctacaaga
ggtactatttttcctaaatctccatttgatgcagagactgattgtgaacttttaagaaaa
gcaatgagaggtgttggaactgatgaagatgctttgattaacatactagttgctccttgt
aatcgtcaaagagttgaaattagactaagatataaaaccatgtttggaaaggatttaatg
aatgatttaaagtcagaactaagtggaaatttagaggagactcttttagctcttttggaa
cctactgttctttatgatgctaaatgtttaagaaaagcaatggctggtgccggcacagat
gagtcaacactgattgatattttatgttctagaaccaattcacaaatcaaagaaataaag
caggaatactccaattatttcaaacgtgatttagaaaaagattgtgtaagtgaaacaagc
ggacatttcaagaggttgctagtctctatgtgtcagggtaatcgagatgaaacaggagtt
gttgatttagagaaagcaaaaaaggaggcagctgagctttatcaagctggtgaaaaaaaa
tggggaacagatgaatcacgttttaatgtgattttggcatctagaaattttaatcaatta
aaagctacttttgatgaatatgtcaagatttctcaacgggatattttgaatactattgat
cgtgaaatgtctggtgatcttaaagatggtttcaaatgcataatacaatgtgcacgaaac
cccgctgagtattttgctgatcgtttgtggcattcaatgaagggaatgggaactaatgat
agtttattaattcgaataatagtttcgcgatcagaggttgatctagctgatataaaaaca
gctttcttgcgcaagtaccaaaaaacattgtacaagatgatagaaggcgattgcagtggt
gattataaaaagttattacttgctattgtgaaacctgatatttaa

DBGET integrated database retrieval system