KEGG   Hydra vulgaris: 100215034Help
Entry
100215034         CDS       T01080                                 

Gene name
ddc
Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
hmg  Hydra vulgaris
Pathway
hmg00350  Tyrosine metabolism
hmg00360  Phenylalanine metabolism
hmg00380  Tryptophan metabolism
hmg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100215034 (ddc)
   00360 Phenylalanine metabolism
    100215034 (ddc)
   00380 Tryptophan metabolism
    100215034 (ddc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hmg04147]
    100215034 (ddc)
Enzymes [BR:hmg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     100215034 (ddc)
    4.1.1.105  L-tryptophan decarboxylase
     100215034 (ddc)
Exosome [BR:hmg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100215034 (ddc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase SepSecS Aminotran_1_2 CbtA_toxin DUF5601
Motif
Other DBs
NCBI-GeneID: 100215034
NCBI-ProteinID: XP_002159208
Position
Un
AA seq 493 aa AA seqDB search
MKKLLANGVVQLFNFRKFSQKQLCEEKIFGIEEFKKFSKEMIDYVANYYENVEDRKVLPK
IKPGYLKSLIPSKAPVEPDKWENIMDDIEKVIMPGVTHWRHPHFHAFYPTANSFPSVVAD
ILVNALSAPGFSWISMPVSTELEMVMMDWIADLIGLPQYFKFSSNSTGGGVIQSFASDAT
YLTLILARSIALSKKSNKEAQSKLVMYTSSQANYSVIKAALLAGVKLHYVDTDSLFRLDG
TSLAKAIKKDKECGFVPFYLCANLGTTTSCAFDRIEELGPICNKENIWLHVDAAYAGSSF
VCEENRHFMKGIELVDSFNFNLHKWMLVNMDCSALWLKDKSKLSNAFNVEALYLHDSTSE
KIPQYRHWQIPLARRFRSLKIWFTLRLYGQKGIQSYIRNHIELARRFEELVRSDKRFEIC
YPVTMGLVCFRIKGSNELNEKLNMSINSEGSIFITPSKLGDKYILRFVVTYEHANLDHIN
YAWDVIKKHAELL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattacttgctaacggcgtggttcaattatttaatttccgcaagttttctcaa
aaacaattatgtgaagaaaaaatatttggtattgaagaatttaaaaagttttcaaaagaa
atgattgattacgtagcaaactattatgaaaatgttgaagacagaaaagttcttccaaaa
attaaaccaggttaccttaagagtcttataccttcaaaagccccagttgagccagataaa
tgggaaaatataatggatgacattgaaaaagttattatgccaggtgtcactcactggaga
catcctcactttcatgccttttatccaactgcaaacagctttccttcagttgtagctgat
atactagttaatgctttgtctgctccaggattttcttggatatcaatgccagttagtact
gaattagaaatggtaatgatggattggatagcagacctcataggattgcctcagtatttt
aagttttcatcaaacagcactgggggtggcgttatacaaagttttgctagtgatgcaacc
taccttacgctaatactagcgcgttctattgcactatcaaaaaagtcaaataaagaagcc
cagtcaaaacttgtaatgtatacttcaagccaggctaattattcagtaattaaggctgct
ttacttgctggagtaaaactacattatgtagacacagacagcctgtttagacttgatggt
acatctttagcaaaagctataaaaaaggacaaagagtgtggttttgtcccattctatctt
tgtgcaaacttaggtactacaacttcatgtgcttttgacagaattgaagagttaggacca
atatgcaataaagaaaatatttggctgcatgtagatgcagcttatgcgggaagttctttt
gtatgcgaagagaatcgtcattttatgaaaggtattgaactagtagactcgtttaatttt
aacttacataagtggatgcttgtaaacatggattgctctgctctatggcttaaagataaa
agtaaattaagtaatgcattcaatgttgaggctttatatttacatgactctactagtgaa
aaaatacctcaatatcgacactggcagattcctttagcacgtcgctttcgttcacttaag
atatggtttacacttcggctttatggtcaaaaaggaatacagagctatattaggaaccat
attgaactagccaggaggtttgaagaacttgttcgatcagataaacggtttgagatttgt
tatccagtgacaatgggtttggtgtgttttcgtattaaaggaagtaacgagctaaacgaa
aagctgaatatgtcaataaattctgaaggttctatttttattactccttcaaaacttgga
gataaatacattttgaggtttgttgttacttatgagcatgcaaatctagatcatataaac
tacgcatgggatgttattaaaaaacacgccgagttgttataa

DBGET integrated database retrieval system