KEGG   Hydra vulgaris: 101234472Help
Entry
101234472         CDS       T01080                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
hmg  Hydra vulgaris
Pathway
hmg03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101234472
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hmg03041]
    101234472
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     101234472
Spliceosome [BR:hmg03041]
 Complex C
  Other components
   Step II factors
    101234472
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 T2SSE AAA_30 AAA_19 AAA_16 AAA_33 ABC_tran PhoH
Motif
Other DBs
NCBI-GeneID: 101234472
NCBI-ProteinID: XP_012561158
Position
Un
AA seq 1161 aa AA seqDB search
MEELQQLEFLSLVSKVCTELENHLGMNDKTLAEFIIMLAGKSKTVESFKSRLEKNGAEFP
DSLISNLYRLIKALQPVTSSKKKAKKNVVDVEEDSKLVLRKKKFPGLCIPDEPVKKWELE
DEKVAASALDELEALFLKVSSPKNEKGRISESNNEENKKSSRHDRDDKKDSDDYDQRRKR
RSHSPKRERKSDRRKDSNKIPESPEVGKIYDGKITNIMQFGCFVQLFGIRSRVEGLVHIS
QLRKEGRVNDVKEVVTRGQNVKIKVLSIAGKKISLSMKDVDQATGEDLNPGQGIRLPVNS
EVPLRNPDRPSTTTAVPTYEESIDDNTRKKFKRISSPERWEIKQLISAGVLDKADYPDFD
EETGILPKEDDEDDEVEIELVEEEPPFLQGQTKLTINVSPIKIVKNPDGTLPRAAMMQSA
LAKERREIKQQEREAHTESIPKDIAKMWIDPVPQSSEGDKKSIFAQDMRGVLSQEVPEWK
KATFGGKGGSYGRKTTMSIVEQRQSLPIYKLRDELVKAVSDNQILIVIGETGSGKTTQIT
QYLAEEGYTTLGAIGCTQPRRVAAMSVAKRVSEEVGCRLGQEVGYTIRFEDCTSPETKIK
YMTDGMLLRECLLDGELSTYSLIMLDEAHERTIHTDVLFGLLKKAISKRKDLKLIVTSAT
LDAVKFSTYFFEAPIFTIPGRTYPVEVLYTKEAETDYLDAALITVMQIHLTEPPGDILVF
LTGQEEIDTSCEILYERMKSLGPDVPELVILPVYSSLPSEVQTRIFDPAPPGSRKVVIAT
NIAETSLTIDGIHYVVDPGFVKQNVYNSKSGIDQLVVTPISQAQAKQRAGRAGRTGPGKC
YRLYTERAYRDEMLSTNVPEIQRTNLASVILTLKAMGINDLISFDFMDPPPMETLTTALE
ALHSLSALDDEGLLTRLGRRMAEFPLPPQLSKMLIQSVHLACSDEILSIVSMLSVQNVFY
RPKEKQAIADQKKAKFHQIEGDHMTLLAVYNAWKNSKFSNAWCFENFVQARSLKRAQDVR
KQLLGIMDRHKLDIVSCGKNTVRAQKAIVSGYFRNAAKKDPQEGYKTQTDNQAVYIHPSS
ALFNRQPEWVVYHELVLTTKEYMREVTSVDPKWLVEFAPAFYKFADKNKLSKRKREQRIE
PLFNRYEEPNSWRISRAYRMR
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacttcaacagcttgaatttttgtctttggtatctaaagtttgtacggaactg
gagaaccatttaggaatgaatgataaaacacttgctgagtttatcatcatgcttgctggt
aaaagcaaaacagttgaaagttttaaaagtcgattagaaaaaaatggcgctgaatttcct
gattcattgatttcaaatttatatcgccttattaaagctttacagcctgttacctcatca
aagaagaaagcaaaaaaaaatgttgttgatgttgaagaggattccaagttagttctacgc
aagaaaaagtttcctggcttatgtatacctgatgaaccagtcaaaaaatgggagttagaa
gatgaaaaggttgcagcatcagctttagatgagttagaagcattgtttcttaaagtatct
tctccaaagaatgaaaaaggccggatttccgaatctaataatgaagaaaataaaaaaagt
tctcgacatgatagagatgataaaaaggactcggacgattatgaccaaagaagaaaacga
aggtcacactccccaaaaagagaaagaaaatcagacaggcgcaaagatagtaataagatt
ccagagtctcctgaagttggaaagatatatgatgggaaaattacaaacattatgcaattt
ggttgttttgttcaactttttggtattcgctcacgtgttgaaggtctggttcatatctcc
cagttgcgcaaagaaggaagagtaaatgatgttaaggaggtggttacaagaggtcagaat
gtaaaaattaaagttctttctattgctggaaaaaagatcagtttatcaatgaaggatgtt
gatcaagctacaggtgaagacttaaaccctggtcagggtattcgtcttccagttaatagt
gaagttccattaaggaatcctgatagaccttctactacaacagctgttccaacatatgaa
gaatcaatagatgataatacaagaaaaaagtttaaaaggatttcttctccagagcgatgg
gaaatcaagcaattaatatcagctggtgtgctagacaaggctgattatccagattttgat
gaagaaactggaattctaccaaaagaagacgatgaagatgatgaagtggaaattgaatta
gtagaagaagagcctccatttttacaaggacaaactaaacttacaatcaatgtcagtcca
atcaaaattgttaaaaatcctgatggtacacttcctcgtgctgcaatgatgcagtccgca
ctagcaaaagaaaggagagagataaaacaacaagaacgagaggctcacacagaaagtatt
ccaaaagatatcgcaaaaatgtggattgatcctgttccacaatcaagtgagggagataaa
aaatcaatatttgcacaagacatgcgtggtgtactatctcaggaagttcctgagtggaaa
aaagccacatttggtggaaaaggtggctcttatggcagaaaaacaacaatgagcattgtg
gagcaacgtcaaagtctgccaatttataaacttagagatgagttagtcaaggctgtttct
gacaaccaaatacttattgtgattggggaaactggatctggaaagaccacccagataact
cagtatcttgctgaagaaggttatactaccctaggtgctattggttgtacacaaccacgt
cgtgtagctgctatgtctgtggcaaaaagagtatctgaagaagttggttgcagacttggt
caggaagtaggatatacaattcgatttgaagattgtactagtcctgaaaccaagataaaa
tacatgacagatggtatgttgttaagagaatgtctattagatggtgaactttcaacatat
tcattaataatgttggacgaggcacatgaacgaacaatacacactgatgtcttgtttgga
cttttaaaaaaagctatttctaaacgcaaagacttaaaacttatagttacctctgcaaca
ttggatgcagttaaattttctacatacttttttgaagctcctatttttactattcctggt
cgtacttatcctgttgaggttttatatacaaaagaagctgagactgattatcttgatgca
gctttaatcactgttatgcagattcatttgacagaaccaccaggagatattcttgttttt
ttaacaggtcaagaggagatagatacatcatgtgagattctttatgaacgaatgaagtct
ttaggtcctgatgtaccagaacttgttattctacctgtgtattcatcgcttcctagtgag
gtgcaaacaagaatatttgatcctgcacctcctggcagtagaaaggttgttattgctaca
aatatagctgaaacttctcttactatagatggtattcattatgtggtagatccaggtttt
gtaaagcaaaatgtatacaattcaaaaagtggtattgatcagttagttgtcacaccaata
tctcaagcgcaagctaaacaaagagctggtcgtgctggaagaactggaccaggaaaatgt
tacaggttatatactgaaagagcatacagagatgaaatgctttcaactaatgttcctgaa
attcagcgaacaaatcttgctagtgttatcctcactttaaaagctatggggattaatgat
ctcatttcttttgattttatggatcctccaccaatggagacattgacaactgctttagag
gctttgcattctttaagtgcacttgatgacgaaggccttttaactcgactagggagacga
atggcagaatttcctttacctcctcagctttctaagatgctcattcagtctgtacactta
gcatgtagtgatgaaattctttctatagtatctatgttgtcagttcaaaatgtgttctac
aggccaaaggaaaagcaagcgattgctgatcaaaagaaagcaaaatttcatcaaattgaa
ggtgatcatatgacactgctggccgtatataatgcatggaagaatagcaagttttctaat
gcatggtgctttgaaaactttgttcaggcaagatctctaaagcgtgcacaggatgttaga
aaacagttgcttggtataatggacagacacaagcttgatatagtatcgtgcggcaaaaat
actgtaagggctcaaaaagctattgtcagtggttatttcagaaatgctgctaaaaaagat
cctcaagagggttacaaaacccaaactgataaccaggcagtttatatacatccttcaagt
gctttatttaacaggcagccagaatgggttgtttatcacgaacttgttttgacaactaaa
gaatacatgagagaagtaacatcagttgatcctaaatggcttgttgaattcgctcctgca
ttttacaagtttgctgataaaaacaagttaagtaaaagaaaacgcgaacaaaggattgaa
ccattgtttaacagatacgaggaacccaactcttggagaatatcaagagcttacagaatg
cgataa

DBGET integrated database retrieval system