KEGG   Hydra vulgaris: 101238687Help
Entry
101238687         CDS       T01080                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
hmg  Hydra vulgaris
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hmg04131]
    101238687
Membrane trafficking [BR:hmg04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    101238687
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin WD40 WD40_like zf-RING_2 Ist1 Vps39_2 zf-RING_5 zf-C3HC4 zf-rbx1 CCDC-167 zf-C3HC4_2
Motif
Other DBs
NCBI-GeneID: 101238687
NCBI-ProteinID: XP_012556574
Position
Un
AA seq 1063 aa AA seqDB search
MSERKVEDREENFTQNIDDSNEDDDDDDVDDDDDDGKDDVEPKLKYERIGNSILEIFTKD
AASCMAVHSKFLALGTHYGVVHILDHQGNNIRKFPSHATTINQIAIDSNGDYVSSCSEDG
RFIINGLYTTENNTQHNFDCPIRSIGLHPDFGRRGNKQYVIGVGEKLTLFEKGWMRNKSV
ILHSGEGFVRSIKWKNNFIAWANSEGVEVYDINAKERFTHIPRDQTSARDELFHCNLSWK
DDTCFFVAWGNSIKVCIVKERPPNDIRGLPRHFVEIAHIFEIDYFASGIAPFGNEMAVLA
YSFDKEDGAAPTKGTAKRPQLLVIKPEGMYKFEEASIDCLSIRGFEEYKCNNYFLEKVEE
EQLFYIVSPKDIVIARPRDLDDHISWLMENKKFEEALQKAENQQRELKRLSVLEIVKAYL
NYLFANNKFEEAAKLCDRKLGRCKELWEEQIYKFIEKKSLKMVTRYIPRSNPQLDNTIYE
LVLNEYLQTDLEGFHKLLTEWPSNLYKPETIILLLQEKIRETPESLLQRSLATLYAQKQK
FGEALRIYLTLKDPGVFEMIAKHKLLSWVKDKCLQLMEIESNKAVAMFIDNMDHFEVDDV
VKQLNQNEKLLHQYLHGLFTKDPQAGHNYHNKQISLYAEFQPDRLQSFLKNSNFYQLEKA
FKVCEERNLISEMVFLQGRMGNKKEALLLIIDKMCNIQKELLNIILNWRMLLVMLLIMKQ
ILSKQVILTQKAVSPKPIERQNVGLVLKVFCDETVAALRVKFPEAEDTALFIETVVKWWL
IVNSKSKGLDIRLNDIRRKPITSVNDWQIDFLENYISYFAENLKCVNSKLREKKITMDTA
SALQKTSKRLASCAKYLLNCGVSYVLLGHMQSDALEKQFGKYWQGSGGTYLITVQNAIDF
AKEENDTDLWDYLIEKSLPKPEYIKELLISIGTHVDPKLLIKKIPSKMEIPGLRDALVKI
LQDYNLQVYLHEGCKAILDKDSVALYDKQVKNLSKGFLISDIDHCPTCEGKLIVEDNRKA
STIVTFFCKHTYHEVCLRGMSMQPRQTEPFCPTCSSKTSKKKI
NT seq 3192 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaagaaaagtcgaagaccgcgaagaaaattttacacagaatatagatgatagt
aacgaagatgatgatgatgatgatgttgatgatgatgatgatgatggaaaggatgatgtt
gaacctaagctaaaatacgaacgaataggaaattctattctagaaatatttaccaaagat
gcagcaagttgcatggcagtacactctaaatttttggctcttggcacacattatggagtt
gttcatattttggatcatcaaggaaacaatattcgtaaatttccttcccatgcaacaaca
attaatcaaatagcaattgatagtaatggagattatgtttctagctgctctgaagatggc
aggtttattattaatggcctttatacaacagaaaataatacccaacataattttgattgt
cccattcgttctattggcttgcatcctgattttggacgtagaggaaacaaacagtatgta
attggagttggcgaaaaattaacattatttgaaaaaggttggatgcgcaataaatcagtt
atccttcattctggagaagggttcgttcgatcaattaaatggaaaaacaattttattgca
tgggcaaattctgagggtgttgaagtttatgacatcaatgctaaagaaagattcacacat
ataccaagagatcaaacaagtgcacgcgatgagttattccattgtaatttatcttggaaa
gatgacacttgtttttttgtggcatggggaaattcaatcaaagtttgtattgtaaaagaa
agaccacctaatgatataagaggtctacctcgacattttgtagaaattgcacatatcttt
gaaatagactattttgcttctggaattgctccatttggtaatgaaatggctgtattggca
tattcatttgataaagaagatggtgctgctcctacaaagggcactgcaaagcgacctcaa
cttttagttataaaaccagaaggaatgtataaatttgaagaagcatcaattgattgttta
tctattcgcggctttgaagaatacaaatgtaataattattttctggaaaaggttgaagaa
gaacaattgttttacatcgttagtcctaaagatattgtcattgctcgaccaagggatcta
gatgaccatatatcttggcttatggaaaacaaaaaatttgaagaagctttacaaaaagct
gaaaaccagcaaagagaactaaagcgactttctgttttggaaattgttaaagcttatctc
aactatctcttcgccaacaataaatttgaagaagcagcaaagttgtgtgatcgcaaactt
ggcagatgcaaagaactatgggaagaacaaatttataaatttattgaaaagaaatcttta
aagatggtaactcgatatattcctcgttctaatccacaattggataatactatatatgag
cttgtgttgaatgagtatttgcagacagaccttgagggatttcacaagttgcttactgaa
tggccaagtaatctttacaaacctgaaactatcattttgttacttcaggaaaaaattcga
gaaactcctgaatcacttttgcagcgatctcttgctacattatatgcacagaaacaaaag
tttggggaggctttgagaatttatctaaccttaaaggatccaggtgtatttgaaatgatt
gctaagcacaaattgttatcatgggtaaaagacaagtgtttgcaactcatggaaattgaa
tccaataaagcagtagccatgtttattgataatatggatcactttgaagtagatgatgtt
gttaaacaactaaatcaaaatgaaaaacttttacaccagtatttacatggattgtttaca
aaagatccacaggctggtcataattatcacaacaaacaaatttctctatatgcagaattt
caacctgatcggttacaatcttttttaaaaaatagcaatttttatcaactagaaaaggca
ttcaaagtttgtgaagaaagaaatttaatttcagagatggtatttctacaagggagaatg
ggaaataaaaaagaagcccttttgttaattattgataaaatgtgcaatattcaaaaggag
ttattaaatattattctcaactggagaatgctgttagttatgttattaataatgaaacag
attctaagcaagcaagttatattaacacaaaaagctgtgtcaccaaaaccaattgaacga
caaaatgttggattagttcttaaagttttttgtgatgaaacagttgcagcattacgtgta
aaatttcctgaagctgaagatactgcactttttattgaaacagttgttaagtggtggctt
attgtcaacagtaaatcaaaaggtctagatattagattaaatgatattcgaagaaagcct
attacttcagtcaatgattggcaaatagatttcttagagaactatatttcgtattttgct
gaaaatttgaaatgcgtaaattcaaaattaagagagaaaaagataacaatggatactgca
agtgctttgcaaaaaacttctaaaagattagcaagctgtgccaagtatttgttgaattgc
ggtgtatcttatgtattgttaggacatatgcaatcagatgcactagaaaaacagtttggg
aaatattggcaagggtcaggtggcacatatctgataactgtgcaaaatgcaattgatttt
gcaaaggaagaaaatgatacagatctttgggattatttaatagaaaagtctcttccgaag
ccggaatatatcaaagaactattgatcagcattggtacccatgttgatcctaagttacta
atcaagaaaattccatcaaaaatggagattcctggtctgagagatgctttagtgaaaatt
ttacaagattacaatttacaagtttatttgcatgaaggttgtaaagctatattagacaaa
gatagtgttgccttgtatgataagcaggttaaaaatctttcgaaaggatttttaatatct
gatattgatcattgtccaacatgcgaaggaaaattaattgtagaagataacagaaaagct
tcaacaattgtgacatttttttgcaagcacacttatcatgaagtatgtcttcgaggcatg
agcatgcagccaagacaaacagagcctttttgtcctacatgttcaagcaagacatctaaa
aagaagatttag

DBGET integrated database retrieval system