KEGG   Haematobacter massiliensis: HmaOT1_04280Help
Entry
HmaOT1_04280      CDS       T05861                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
hml  Haematobacter massiliensis
Pathway
hml00471  D-Glutamine and D-glutamate metabolism
hml00550  Peptidoglycan biosynthesis
hml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hml00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    HmaOT1_04280
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HmaOT1_04280
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hml01011]
    HmaOT1_04280
Enzymes [BR:hml01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     HmaOT1_04280
Peptidoglycan biosynthesis and degradation proteins [BR:hml01011]
 Precursor biosynthesis
  Amino acid ligase
   HmaOT1_04280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: QBJ23544
UniProt: A0A086YB13
Position
533504..534907
Genome map
AA seq 467 aa AA seqDB search
MIPVRGVEGQRVAVLGLGRSGLATARALIAGGAEPLLWDDSPESRTRAEAEGFSLHDLTR
DGAWKGVSVLVVSPGIPHLYPQPNRIILQAMTEGVPVDNDIGLFFRSWGDAEWARYDQPP
RVIAVTGSNGKSTTTALIHHILTVAGRPTQMAGNIGRGVLDMEPPMDGEVVVLELSSYQT
ELARALTPDIAVFTNLSPDHLDRHGGMGGYFAAKRRLFAEGGPDRAVIGIDETEGLFLAN
QLSQGPADDRVIRISIARKLEGEGWSVFARRGFLSEWRKGRQVAAIDLRKVRGLPGAHNH
QNACAAYAATRTLGIAPRVIEQAFLSFEGLPHRSQIVAERAGVTFVNDSKATNVDSAAKA
LAAFPRIRWIAGGLGKEGGIATLKPLLGSVVKAYLIGHSARDFALQIGETPHEICETLDQ
AVARAAEEAGAGETVLLAPAAASFDQYPNFEKRGEHFMELVRALPPA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgataccggtcaggggtgttgagggacagcgcgttgcggttctggggctgggccggtcg
ggtctcgcaacagcgcgggccttgatagcgggcggcgcggagccgctgttgtgggacgac
agcccggaatcgcgcacccgcgccgaggctgaggggttttcccttcacgacctgacacgc
gatggcgcctggaaaggtgtttcggtgttggtggtgagccccggtatcccgcatctctac
ccgcaacccaaccgaatcatccttcaggcgatgaccgaaggtgtgccggtcgataacgat
atcggcctgttcttccgctcctggggggacgcggagtgggcgcgctacgatcaaccgccg
cgcgtcatcgcagtcaccggctccaacggcaaatccacaaccacggcgcttatccaccat
atcctgaccgtcgccggccggcctacacagatggcgggcaacatcggtcgtggcgttctg
gacatggagcctccgatggacggcgaggtggtcgtgctggagctgtcttcctatcagacg
gagcttgcgcgcgcgctcacgccagacatagccgtgttcaccaacctgtcgcccgatcac
ctggaccggcatggcggcatgggcggttattttgccgcgaagcgccgactgttcgcagag
ggcggcccggatcgcgctgtcatcggcatcgacgagacggagggattgttcctcgcgaac
cagctgtcgcaggggccagcggatgatcgcgtcatccgcatctccatcgcccggaagctg
gagggggaagggtggagcgtctttgcccgccgcggtttcctatcggaatggcgcaagggt
cgtcaggtcgccgccatcgacctgcgcaaggtcaggggcttgccgggcgcgcacaatcat
cagaatgcctgcgcggcctatgcggcgacgcgcaccctcggcatcgcgccgcgcgtgatc
gagcaggcattcctgagcttcgaggggctgcctcaccgcagccagatcgttgcggagcgc
gcgggcgtgacctttgtcaacgattccaaggcgaccaacgtggattcagcggccaaggcc
ctggccgcctttccgcgtatccgctggattgcgggcgggctcggcaaggaaggcggcatc
gcgacgctgaagcccctgctcgggtcggtggtgaaggcctatctcatcggccactccgcc
cgggatttcgcgctccagatcggcgagacaccgcacgaaatctgcgaaacactcgaccag
gccgttgcccgtgccgccgaggaggcgggggcaggcgagaccgttctgctcgcccctgcc
gccgcgagcttcgatcaatatccgaacttcgagaaacgcggagagcatttcatggaactg
gtccgcgccctgccccctgcatga

DBGET integrated database retrieval system