KEGG   Haematobacter massiliensis: HmaOT1_05870Help
Entry
HmaOT1_05870      CDS       T05861                                 

Definition
(GenBank) HAD family phosphatase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
hml  Haematobacter massiliensis
Pathway
hml00361  Chlorocyclohexane and chlorobenzene degradation
hml00625  Chloroalkane and chloroalkene degradation
hml01100  Metabolic pathways
hml01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hml00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HmaOT1_05870
   00361 Chlorocyclohexane and chlorobenzene degradation
    HmaOT1_05870
Enzymes [BR:hml01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     HmaOT1_05870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: QBJ23820
UniProt: A0A086XZC4
Position
861597..862229
Genome map
AA seq 210 aa AA seqDB search
MTAQPPSAVVFDIGNVLIEWQPERFFDGVMPAGDRARMFAEIDLHGMNDGIDRGESFRDA
VYAAADRHPAWRPQIRLWHDRWLDIAQPAIPGSVHLLRALRRKGIPVFALTNFGVETFAL
ARKAYPFLDEFDRRYVSGELKVIKPDPRIYAILEQDSGVAPGDLLFTDDRIDNIAAASAR
GWRTHHFDGPEGWGRRLVQEGLLTEEEARP
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacagcccccaagcgccgttgtcttcgacatcggcaacgtgctgatcgaatgg
cagccggagcgcttcttcgatggcgtcatgcccgccggagaccgcgcgcggatgttcgcg
gagatcgacctgcacggcatgaacgatggcatagaccggggcgagagctttcgcgatgcc
gtttatgccgccgccgaccgtcaccccgcctggaggccgcagatccggctgtggcacgac
cgctggctggatatcgcgcagccggcgatacccggttcggtgcatctgttgcgggcgctt
cggcggaaggggatcccggtctttgccctgaccaacttcggagtggagacattcgcgctc
gcccggaaggcctatccgtttctggatgaattcgaccgccgctatgtctccggcgaactg
aaggtcatcaagccggaccctcgcatctacgcgattctggagcaggacagcggcgttgcg
cccggcgacctcctcttcactgatgaccggatcgataatatcgcggcggccagcgcgcga
ggatggcggacacaccatttcgacggccctgagggctgggggcggcggctcgtccaggaa
ggcttgctgacggaggaggaagcacggccatga

DBGET integrated database retrieval system