KEGG   Haematobacter massiliensis: HmaOT1_09670Help
Entry
HmaOT1_09670      CDS       T05861                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hml  Haematobacter massiliensis
Pathway
hml00010  Glycolysis / Gluconeogenesis
hml00020  Citrate cycle (TCA cycle)
hml00620  Pyruvate metabolism
hml01100  Metabolic pathways
hml01110  Biosynthesis of secondary metabolites
hml01120  Microbial metabolism in diverse environments
hml01130  Biosynthesis of antibiotics
hml01200  Carbon metabolism
Module
hml_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HmaOT1_09670
   00020 Citrate cycle (TCA cycle)
    HmaOT1_09670
   00620 Pyruvate metabolism
    HmaOT1_09670
Enzymes [BR:hml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HmaOT1_09670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N HlyD_3 RnfC_N
Motif
Other DBs
NCBI-ProteinID: QBJ24497
Position
1639391..1640704
Genome map
AA seq 437 aa AA seqDB search
MATEILMPALSPTMEEGTLAKWLVKEGDTVSSGDIIAEIETDKATMEFEAVDEGVIGKLL
VPEGTAGVKVNAPIAVLVEDGESVGDTPAPKAAAKAEEAPKQAAAAPEAAPKAVEKAPAR
AEGARVFASPLARRIAAEKGLDLSAVAGSGPHGRIVKADVETAKPGQPASAPAAEAKAST
PEPKPEPQKAAMATGASADTVKKLYADRDYEEVTLDGMRRTIAARLTEAKQTIPHFYLRR
EIRLDALMEFRQTLNHQLAGRGVKLSVNDFIIKAGAVALQQVPDANAVWAGDRILKLKPS
DVAVAVAVEGGLFTPVIRDADKKSLSALSAEMRDLAHRARDRKLAPHEYLGGSFAISNLG
MYGIDNFDAVINPPHGSILAVGAGVKKPVVGKNDEIEVATVMSVTLSVDHRVIDGALGAE
FLKAMADLLENPILMVA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgaaatcctgatgcctgccctgtctcccacgatggaggaagggacgctcgcg
aaatggctggtcaaggagggggataccgtctcctccggcgacatcatcgcggaaatagag
actgacaaggccacgatggaattcgaggctgtggacgagggggtcatcggcaagctcctc
gtccccgagggtactgcgggcgtgaaggtgaacgcgcccatcgccgtgctggtcgaagac
ggcgaaagcgtgggcgatacccccgcgcccaaagccgcggccaaggcggaggaggctccg
aaacaagccgccgctgcgcccgaagccgcgcccaaggccgttgaaaaggcgcccgcgcgc
gccgagggcgcgcgtgtcttcgcctcgcccctcgcccgccggatcgcggcggaaaagggc
ctcgacctttctgccgttgccggctccggcccgcacggccggatcgtgaaggccgatgtg
gaaacggcgaaacccggccagccggccagcgcccctgcggcggaagccaaggcctccacg
ccggagccgaagcccgaaccgcagaaagcggccatggctaccggcgcctctgcagatacg
gtcaagaagctctacgccgaccgcgattatgaggaagtgacgctcgacgggatgcgccgt
accatcgccgcgcgactgaccgaggccaagcagaccatcccgcatttctatctgcgccgc
gagatccggctcgatgcgctgatggagttccgccagaccctcaaccaccagcttgcgggc
cggggggtgaagctgtcggtcaacgacttcatcatcaaggcgggtgcggtcgcgctgcaa
caggtgcccgatgccaatgccgtctgggcgggcgaccgtatcctgaagctgaagccttcc
gacgtggcggtcgccgtggcggtagagggcggcttgttcacgccggtgatccgcgatgcg
gacaagaagtctctctccgccctgtcggcggagatgcgcgaccttgcccatcgggcacgg
gaccgcaagcttgcgccgcatgagtatctcggcggcagtttcgccatttccaacctcggc
atgtatggcattgacaacttcgatgccgtcatcaacccgccgcatgggtcgatcctcgcc
gtcggggcgggcgtaaagaagccggtcgtcggcaagaacgatgagatcgaggtggctacg
gtcatgtccgtgaccctctccgtcgatcaccgcgtgatcgatggggcattgggggcggaa
ttcctcaaggctatggctgacctgctcgaaaacccgatcctgatggtagcatga

DBGET integrated database retrieval system