KEGG   Haematobacter massiliensis: HmaOT1_15985Help
Entry
HmaOT1_15985      CDS       T05861                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
hml  Haematobacter massiliensis
Pathway
hml00053  Ascorbate and aldarate metabolism
hml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    HmaOT1_15985
Enzymes [BR:hml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     HmaOT1_15985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_10 Polysacc_synt_2 RmlD_sub_bind GCV_T_C
Motif
Other DBs
NCBI-ProteinID: QBJ25842
UniProt: A0A086Y4M5
Position
pOT1-2:complement(103062..103877)
Genome map
AA seq 271 aa AA seqDB search
MTTPRYDTILITGAAGMLGTELRKGLAPFARKLRLNDRVEIADLQPNEEAVICDLGDMAA
VSGMVEGVDAIVHFGGASRERPWDDVLNSTIAGSYNIYESARQHGVKRIVFASSVHAIGF
HKLESHIDATTPPRPDTLYGLSKCFVEDLSRLYWDKWGIETLCLRIFSSFPEPEDHRHLW
SWLSFRDCVQYVTRGLMAPRVGHTIAFGMSDNRLKVVDDSKAGHIGYQPQDNTEAFRAKV
EGSVPWPDPHAPEVKRYGGVYVTFPHPDDPA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccccgctatgacacgatcctcatcaccggcgcggccgggatgctgggcacg
gaactgcgcaagggtctggcacccttcgcccgcaagctgcggctgaacgaccgggtggag
atcgccgatcttcagccgaacgaagaagccgtgatctgcgatctgggcgacatggccgcg
gtgagcgggatggtcgagggcgtcgatgccatcgtgcatttcggcggcgcctcccgcgag
cgcccctgggacgacgtgctgaactccactatcgccggcagctacaacatctatgagagc
gcgcggcagcatggtgtgaagcggatcgtcttcgcctcctccgtccatgccatcggattc
cacaagctggaaagccatatcgacgcgacgacacctccgcggcccgacacgctctacggc
ctgtcgaaatgtttcgtggaagacctgtcgcggctctactgggacaaatgggggatcgag
acgctgtgcctgcgcatcttctcctccttcccggagccggaagaccaccgtcacctgtgg
tcctggctctccttcagggactgtgtgcagtatgtcacccgcgggctgatggcgccgcgc
gtcggccataccatcgccttcggcatgtcggacaaccgcttgaaagttgtggacgattcc
aaggctggccacatcggctaccagccgcaggacaatacggaggcgttccgcgccaaggtg
gaaggatcggtcccctggcccgacccgcacgcgcccgaagtcaagcgctacggcggcgtc
tatgtgaccttcccgcatccggacgacccggcgtga

DBGET integrated database retrieval system