KEGG   Halobacillus mangrovi: HM131_01030Help
Entry
HM131_01030       CDS       T04799                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
hmn  Halobacillus mangrovi
Pathway
hmn00620  Pyruvate metabolism
hmn00630  Glyoxylate and dicarboxylate metabolism
hmn01100  Metabolic pathways
hmn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HM131_01030
   00630 Glyoxylate and dicarboxylate metabolism
    HM131_01030
Enzymes [BR:hmn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     HM131_01030
    1.2.1.22  lactaldehyde dehydrogenase
     HM131_01030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1487 Phage_ABA_S Neugrin
Motif
Other DBs
NCBI-ProteinID: ARI75495
UniProt: A0A1W5ZQC6
Position
complement(174585..176036)
Genome map
AA seq 483 aa AA seqDB search
MKEHQLYINGEYTASTGNEWIDIINPATEEVISKTPKGTKEDVDRAVQAAVEAQKGWELT
PNIERGKIVRQLGDRIEENRATFIDLLQEEQGKDYELASGEVDLAIDYFRYMSEWARRIE
GEIVPSDRANENIFIYKKPIGVVGGIVPWNFPVFILARKVATALVTGCTIVLKPSQQTPN
TAMEFTKIIHSMEEIPKGVYNVVTGTGSEIGNALASHKNVHMISMTGSVPAGTKVMEAAA
QNITKVNLELGGKAPAIVTANADLDVAAENITTSRLANNGQACTNAERVYVHESVADELI
EKLRHRFESLTIGDPRENKDADVGPLVSKDRLEEVEQMVKEAVNAGAKVEIGGERPDLEK
GFFFKPTILTNVEHDMDIMQEEIFGPVIPVTTFKTLDEAIEKGNDTDYGLSSSVYTENMH
EAMRVVNELKFGETFVNRENFEAVQGYHAGMRKSGLGGADGKHGMEDFLVTQVVYMQYKN
DKQ
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggaacatcaactctatattaatggtgaatatacagcatcaaccggaaacgaatgg
atcgatattataaatccagcgacagaagaagtcatttcaaaaacaccaaaagggacaaaa
gaggatgtagaccgtgcagttcaggcagcagtggaagcccagaaaggctgggagttgact
ccgaacatcgagcgtggaaaaattgtgcgtcagttaggagatcgaattgaagagaatcgg
gcaaccttcatcgaccttttgcaagaagaacaagggaaagactacgagcttgcgagtggt
gaagttgatttagctatcgattatttccgctacatgtccgaatgggcacgccgaattgaa
ggagaaatcgttcccagtgaccgtgcgaatgaaaacatatttatctataaaaagccaatt
ggggtcgtgggtggaatcgttccatggaactttcctgtcttcatattggccaggaaagtc
gctacagccctagtaactggctgtacgattgtgttgaaaccaagtcagcagactcctaat
acggctatggaatttactaagatcatacattctatggaggaaatccctaaaggtgtgtac
aatgtcgttaccggaacaggatcagaaataggaaatgccctcgcatcccataaaaatgtc
catatgatttcgatgacagggagtgtccctgcaggtaccaaagtaatggaagcagctgcg
caaaacataacgaaagtgaacctggagttaggaggtaaggctcctgccatcgtaacagct
aacgcagatcttgatgtcgcagcagagaacatcactacttcaaggctggcaaacaatggt
caggcgtgtacgaatgcggagagggtatatgtccatgagagtgtggccgatgagcttatt
gaaaaattacggcatcgctttgaatctctgaccattggagatccacgtgaaaataaggat
gctgatgtaggtccgcttgtcagcaaggatcgcctggaagaagtcgaacaaatggtgaaa
gaagcggtcaatgcaggagcgaaagtagaaatcggtggagaaagacctgatcttgagaaa
ggcttctttttcaaaccaaccattctaactaacgtggagcatgacatggatattatgcaa
gaagagatctttggaccggttattcctgtaacaacatttaaaactcttgatgaagcgatt
gaaaaagggaatgacacagactatggactttcttcttctgtctataccgaaaatatgcat
gaggcaatgcgagtcgtcaatgaattgaaatttggtgagacgttcgtaaaccgagagaat
tttgaagccgttcaaggctatcatgccggaatgcgtaaatccggcttaggtggtgcagat
gggaagcacggaatggaagactttcttgtcacccaagtcgtctatatgcaatataaaaac
gataaacaataa

DBGET integrated database retrieval system