KEGG   Halobacillus mangrovi: HM131_03965Help
Entry
HM131_03965       CDS       T04799                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hmn  Halobacillus mangrovi
Pathway
hmn00071  Fatty acid degradation
hmn00072  Synthesis and degradation of ketone bodies
hmn00280  Valine, leucine and isoleucine degradation
hmn00310  Lysine degradation
hmn00362  Benzoate degradation
hmn00380  Tryptophan metabolism
hmn00620  Pyruvate metabolism
hmn00630  Glyoxylate and dicarboxylate metabolism
hmn00640  Propanoate metabolism
hmn00650  Butanoate metabolism
hmn00900  Terpenoid backbone biosynthesis
hmn01100  Metabolic pathways
hmn01110  Biosynthesis of secondary metabolites
hmn01120  Microbial metabolism in diverse environments
hmn01130  Biosynthesis of antibiotics
hmn01200  Carbon metabolism
hmn01212  Fatty acid metabolism
hmn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HM131_03965
   00630 Glyoxylate and dicarboxylate metabolism
    HM131_03965
   00640 Propanoate metabolism
    HM131_03965
   00650 Butanoate metabolism
    HM131_03965
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HM131_03965
   00072 Synthesis and degradation of ketone bodies
    HM131_03965
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HM131_03965
   00310 Lysine degradation
    HM131_03965
   00380 Tryptophan metabolism
    HM131_03965
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HM131_03965
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HM131_03965
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HM131_03965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hmn04147]
    HM131_03965
Enzymes [BR:hmn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HM131_03965
Exosome [BR:hmn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HM131_03965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARI76040
UniProt: A0A1W5ZRV0
Position
795774..796961
Genome map
AA seq 395 aa AA seqDB search
MRKTVIVSGARTPFGKFGGALAPLTAAQLGGIVIKEALKRANFNAEDVNEVIMGTVLQGG
QGQLPSRQASREAGIPWDVKTETVNKVCASGMRSVTMADQFIRLGDEEVIVAGGMESMSN
APYFMPKARWGLRMGDSPVKDMMVHDGLTCSFENVHMGNYGNRTAEEFELTREAQDEWSY
RSHQRAVKAIEEGTMAEEIVSVEVPQRKGDPISVERDEAPRKNTTVEALSKLRPVFDKNG
TITAGNAPGVNDGACAMLLMSDEKAKELGADTLATILAHDEVAVEAQDFPQTPGLVINKL
LEKAGKSIDEIDLFEVNEAFAAVSLASGKIAGLDPEKVNVNGGAVALGHPIGASGARILL
TLAYELKRRGGGLGIAAICSGGGQGDAVLIEVPKQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaacagtaatcgtttcaggagcacgtacaccttttggaaaattcggaggagct
ttggcaccactgactgccgctcagcttggggggattgtgattaaagaagcgttgaagcgt
gcaaatttcaatgctgaagatgtaaatgaagtcatcatgggcacagttttgcaaggtggt
caaggccagcttccgtctcgccaggcctctcgtgaagcaggtatcccgtgggatgtaaag
acagaaacggtcaacaaagtgtgtgcgtctggaatgagaagtgtgacaatggcggatcag
tttattcgactaggggacgaagaagtcattgtggccggaggaatggaaagtatgagcaat
gcgccttactttatgccaaaagcacgctggggtttacgcatgggagattctcctgtgaaa
gatatgatggttcacgatggacttacgtgttcctttgaaaatgtacacatggggaattac
ggcaaccgcacggcagaagaattcgagctgacaagagaagcacaggatgaatggtcctac
cgcagtcatcagcgcgccgttaaagcaattgaagaaggaacaatggctgaagaaatcgtg
tctgtagaagtacctcagcgaaaaggagatccgatttctgtagagcgtgacgaagctcca
agaaaaaataccacagtcgaagcattatccaaattacgtccggtttttgacaagaatgga
acgattacagcaggtaacgcaccaggagtcaatgatggtgcttgtgcaatgcttctgatg
tcagatgagaaagcgaaagagctgggagcagatacactggctacgattctggcacacgat
gaagtagctgttgaagcacaagactttcctcagacaccgggacttgtgatcaataaactt
ttagaaaaagcagggaaatccatagacgaaatcgatttgtttgaagtaaacgaagcattc
gcagccgtctcgctggcaagcggtaaaattgctggtcttgatcctgaaaaagtaaacgtc
aatggtggagctgttgcgcttggtcacccaattggagcaagcggtgcaagaattttactt
acactggcttatgaattaaaacgccgtggcggtggtcttggaatagctgcgatctgttca
ggcggcggtcaaggcgatgctgttctaatcgaagtaccgaaacaatag

DBGET integrated database retrieval system