KEGG   Halobacillus mangrovi: HM131_08055Help
Entry
HM131_08055       CDS       T04799                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
hmn  Halobacillus mangrovi
Pathway
hmn00430  Taurine and hypotaurine metabolism
hmn00620  Pyruvate metabolism
hmn00640  Propanoate metabolism
hmn00680  Methane metabolism
hmn01100  Metabolic pathways
hmn01120  Microbial metabolism in diverse environments
hmn01200  Carbon metabolism
Module
hmn_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:hmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HM131_08055
   00640 Propanoate metabolism
    HM131_08055
  09102 Energy metabolism
   00680 Methane metabolism
    HM131_08055
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    HM131_08055
Enzymes [BR:hmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     HM131_08055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ARI76796
UniProt: A0A1W5ZU12
Position
1665566..1666756
Genome map
AA seq 396 aa AA seqDB search
MSNKILAINAGSSSLKFQLIEMPEETVITKGLVERIGLNDAVFTIEVGEEKDKTITDIPD
HGEAVRLLLDKLTANGIIESLDEINGVGHRVVHGGERFSESVLITDEVIQEIEEVSDLAP
LHNPANLTGIRAFREVLPNVPHVAVFDTAFHQSMPEQSYLYSLPYEYYEKYGIRKYGFHG
TSHKYVSERAAEMLGRPVEQLRILSCHLGNGASIAAIEGGKSIDTSMGFTPLAGVTMGTR
SGNIDPALIPFIMEKTGKTANEVMNVLNKESGMLALSGFSSDLRDIEERASEGDERAELA
LEVFAARIHKYIGSYAARMHGIDAIVFTAGVGENSTSIRERVLKGLEFMGVYWDPSLNQV
RGKEAFVNYPHSPVKVMIIPTNEEVMIARDTVEKGM
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaataaaattcttgctataaatgcaggtagttcatcactgaaattccaattgatt
gaaatgcctgaagaaacggttataacaaaaggtctagtggaacgtatcggccttaacgat
gcggttttcacgattgaagtaggagaagaaaaagataagacgattactgatatccctgac
catggtgaagctgttaggttgctattagataaactaactgctaacggtatcattgaatcc
cttgatgagatcaatggagttgggcaccgcgtcgtacacggaggcgagcgcttcagtgaa
tctgtgttaattacggatgaagtcattcaagaaatagaagaagtgtctgacttggcacca
cttcataaccctgcgaacttgacaggtattcgtgccttccgtgaagtactgccaaatgtg
cctcacgttgctgtatttgatacagcctttcaccagtctatgccggagcagtcttacctt
tacagcttgccttatgagtattatgagaagtatggcattcgtaaatatggtttccacggt
acctcccacaaatatgtatctgagcgtgctgcggaaatgcttggtcgtccggtagagcag
cttcgcatcctttcctgtcacttaggtaacggtgcaagtatcgctgccatcgaaggcgga
aagtcaatcgatacttccatgggattcacgccacttgctggtgttacaatgggaactcgt
tctggtaacattgatccggccttgattccattcattatggagaaaacgggtaaaacagcg
aatgaagttatgaacgtcctgaacaaagaaagtgggatgttagctctttctggtttctca
agtgacttacgtgacattgaagagcgtgcttctgaaggtgatgagcgtgctgagcttgca
cttgaagtatttgctgcccgtatccacaagtacattgggtcttatgctgctcggatgcac
ggaattgatgcgatcgtctttactgctggtgtaggagaaaacagtacatccatccgtgag
cgtgtccttaaaggactagagttcatgggcgtttactgggatccttccttaaaccaggtt
cgtgggaaagaagcattcgtcaactacccgcattcaccagttaaagtcatgattattccg
acaaacgaagaagtcatgatcgcccgtgatacggtagaaaaaggtatgtaa

DBGET integrated database retrieval system