KEGG   Halobacillus mangrovi: HM131_17790Help
Entry
HM131_17790       CDS       T04799                                 

Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
hmn  Halobacillus mangrovi
Pathway
hmn00250  Alanine, aspartate and glutamate metabolism
hmn00330  Arginine and proline metabolism
hmn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HM131_17790
   00330 Arginine and proline metabolism
    HM131_17790
Enzymes [BR:hmn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     HM131_17790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh YvbH_ext
Motif
Other DBs
NCBI-ProteinID: ARI78575
UniProt: A0A1W5ZZ09
Position
complement(3550811..3552361)
Genome map
AA seq 516 aa AA seqDB search
MVVPYKHEPFTDFSVEENRRALEAAIKQVESDLGKDYPLIIGGERIMTDDKIKVVNPANK
KEVIGYVSKANQDLAEKAHRIADETFDWWRKTKAQFRADILFRAAAIVRRRKHEFTAHLV
KEGGKPWKEADADTAEAIDFMEFYGRQMLEIDKGVEINSRPIENNRFHYIPLGVGVVISP
WNFLFAIMCGTTVAAMVSGNTVLLKPASATPIIAYKMMEVLEEAGLPKGVINYIPGSGKE
VGDYLVDHPRTRFVSFTGSREVGTRIFERAAKVHEGQKWLKRTIIEMGGKDTIVVDKDSD
LELAADAITYSAFGFSGQKCSACSRVVAHEEVYDELLDRVVHKTKEHVNYGDPTDNSHYM
GPVIDQGAYDKIMDYIKIGKEEGKLMAGGKGDDSKGWFIEPTVFADLAPDATIMQEEIFG
PVVGFTKAKSFDEALEIANNTEYGLTGAVISNNRAHIEKAREDFHVGNLYFNRGCTAAIV
GYHPFGGFNMSGTDSKAGGPDYLIHHMQGKTTSEML
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggtagtaccttacaaacatgaaccatttaccgattttagcgtggaagaaaatcgtaga
gcattggaagctgcgatcaaacaggttgagtctgacttaggcaaagactacccgttaatt
atcggcggagaaaggatcatgacggatgacaagattaaagtcgtgaatccagcaaataag
aaagaagttattggttatgtttcaaaagcgaatcaggatttggctgagaaagctcaccga
atcgcagacgaaacgttcgactggtggcgcaagaccaaagcccagtttcgcgcggacata
ctgttccgtgctgcagcgatcgtccgccgtcgtaagcatgaattcactgcgcatctagtc
aaagaaggtggaaagccttggaaagaagcagatgcagatacagctgaagctattgatttt
atggagttttacggacgtcagatgcttgagattgataaaggagtagaaatcaactcacgt
ccaatcgaaaataaccgtttccactacattccacttggtgtcggagttgtcatttcccca
tggaactttttgttcgccatcatgtgcggaacgacggttgcagccatggtttccggcaac
accgtattacttaaaccagcaagcgcaacacctattatcgcttataagatgatggaagtg
cttgaagaagcaggtcttcctaaaggtgttatcaattatattccaggaagcgggaaagaa
gtgggcgactaccttgtcgatcacccacgcactcgttttgtaagctttactggatcccga
gaagtcggtacacgcattttcgaacgtgccgcgaaagttcacgaaggtcaaaaatggttg
aagcgcacaattatcgaaatgggcggtaaagataccattgtcgttgacaaagattccgat
cttgagctagctgcagatgcaattacgtattctgctttcggtttctcaggtcaaaaatgt
tcggcttgctcccgtgtcgtagcgcatgaagaagtgtatgacgagcttcttgaccgtgtg
gttcataagacaaaagaacacgtcaattacggtgatcctacagacaatagccattatatg
gggccggtcatcgaccaaggtgcttatgacaagattatggactatattaagattggtaaa
gaagaaggtaagctaatggctggcggtaaaggcgacgatagtaaagggtggtttatcgag
ccgactgtctttgctgaccttgcacctgatgcaaccattatgcaggaagaaatttttgga
cctgtcgtcggtttcacaaaagcgaagtcattcgatgaagctttggaaatcgcgaacaat
acagaatatggactgacaggggcggtcatttccaacaaccgtgcccatattgaaaaagca
cgtgaagatttccatgtcggaaacctttacttcaaccgtggatgtacagcggctatcgta
ggctaccatccattcggcgggttcaacatgtctggaaccgactccaaagcgggcggaccg
gattatttaattcaccatatgcaaggaaaaacaacatctgaaatgttataa

DBGET integrated database retrieval system