KEGG   Halobacillus mangrovi: HM131_18285Help
Entry
HM131_18285       CDS       T04799                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase PdxA
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
hmn  Halobacillus mangrovi
Brite
KEGG Orthology (KO) [BR:hmn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HM131_18285
Enzymes [BR:hmn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     HM131_18285
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     HM131_18285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: ARI78668
UniProt: A0A1W5ZZB8
Position
complement(3655864..3656877)
Genome map
AA seq 337 aa AA seqDB search
MSSTKPSIAITMGDPSGIGAEITVKALNDPDIYEQCNPFVIGDLKILRRALHVTGVELEL
HPITEPKDAEYQHGTIDILDLDLVTEDLKWGEVSSEAGNAAFHYLKKAIALTNENKIHGI
CTAPLNKEALHKAGHIYPGHTEILAELTNTKDYAMMLSAPDLRVIHVTTHIGLMDAIKKI
DSDRVYKVIELADTTLKKAGIESPRIAVCGINPHAGENGLFGNGEEEEKVIPGIQKAQES
GINVQGPLPADTLFFRAKRGDFDIVVAQYHDQGHGPIKVLGLEAGVNITVGLPIIRTSVD
HGTAFDIAGKNIASELSLKEALHLAIELAPRENVLQQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaactaagccttccattgccattacaatgggcgacccatctgggataggagca
gaaatcactgtgaaagcattaaatgatcctgacatttatgaacaatgtaacccatttgta
ataggtgatttaaagattctcagacgtgctcttcatgtaacaggggtagaactagaatta
catcctattactgagccgaaagacgcggaataccaacatggaacgattgatatattggat
cttgatctagtgacagaggacttgaaatggggagaagtatctagcgaagcaggtaatgca
gccttccactatttaaaaaaagcaatagctttgacaaatgaaaataaaatacatgggatt
tgcacggcacctctaaataaagaggcacttcataaagcagggcatatctaccctggacac
acagaaatattagcggaattaacgaatacaaaggattacgcaatgatgctttctgcgcct
gaccttagagttatccatgtgaccactcatattggtttaatggatgctattaaaaaaatt
gattcagatcgagtgtataaggttattgaactagctgatactaccttaaagaaggctggt
attgaatcaccccgtattgctgtttgtggtataaaccctcatgcaggtgaaaatggtctg
tttggaaatggagaagaagaagagaaagtgatccctggaattcagaaggctcaagagagc
ggaatcaatgttcaagggccactgcctgcagatacattattctttagagctaaacgtgga
gattttgatatcgtagtggctcaatatcatgatcaaggtcatggtcctattaaagttcta
ggtctagaagctggagtcaatattacggtaggccttccaatcatccggacaagtgtagac
catgggactgcttttgatattgctggtaagaacattgctagtgagctctcactgaaagaa
gcccttcacctggcaattgaactagcacctcgagaaaatgtattacaacaataa

DBGET integrated database retrieval system