KEGG   Heliobacterium modesticaldum: HM1_0686
Entry
HM1_0686          CDS       T00653                                 

Gene name
bchN
Definition
(GenBank) light-independent protochlorophyllide reductase, n subunit
  KO
K04038  light-independent protochlorophyllide reductase subunit N [EC:1.3.7.7]
Organism
hmo  Heliobacterium modesticaldum
Pathway
hmo00860  Porphyrin and chlorophyll metabolism
hmo01100  Metabolic pathways
hmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HM1_0686 (bchN)
Enzymes [BR:hmo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     HM1_0686 (bchN)
SSDB
Motif
Pfam: Oxidored_nitro
Other DBs
NCBI-ProteinID: ABZ83866
UniProt: B0TBM7
Position
1300946..1302277
AA seq 443 aa
MEGIERENGCFHTFCPIASVAWLHRKIKDSFFLIVGTHTCAHFIQTALDVMVYAHSRFGF
AVLEESDLVAASPTAELAKVVEDIKAEWQPKVIFLLSTCSCDILKLDLENSSKDLTIRFG
FPVVPVQTSGLDRTFTQGEDAVLHALLPFVPKEDPKVAVVEEKKRSWFSFGKDEGNKASV
PAAPTRNLVLVGAVTDSTTQQLQWELKQLGLERVDVFPSGDITNMPVINEHTVIVPLQPY
LSDTLATLRRERGAKVLTTLLPIGPDGTARFLEAICAEFGLDASPVAEREAQTWRSLESQ
RALLRGKRIMFLGDNLLEIPLARFLTACGAEVVEAGTPYVHAKDLSEEIARLREKGVPIV
ESPNFSAQVERIDRLRPDLIVAGLGICNPLEAAGYTTAWSIEFTFAQIHGFVNAIDLIKL
FVKPLLKRQALLEQGWTEAGWMS
NT seq 1332 nt   +upstreamnt  +downstreamnt
gtggaagggatcgaacgggaaaacggctgcttccacaccttctgtcccatagccagtgtc
gcttggctccatcgcaagatcaaggactccttctttctgatcgtgggcacccacacctgc
gcccatttcatccagacagccctcgacgtcatggtctacgcccattcccgcttcggcttc
gccgtcctggaggagtcggatctggtggcggcctcgccgacagcggaactggcgaaggta
gtcgaagatatcaaggccgaatggcaaccgaaagtgatcttcctgctgagcacctgcagt
tgtgatatcctgaaactcgatttggagaactccagcaaagacctgaccatccgcttcggc
ttccctgtcgtgcccgttcagacctcgggcctggaccggacattcacccaaggggaggat
gcggtgctgcatgcgctgcttccctttgttcccaaggaggatccgaaggtagcagtcgtg
gaagagaaaaaacggagctggttttccttcggcaaggatgaggggaacaaggcgagtgtc
ccggcggcgccgacgcgcaacctggtcctggtcggtgccgtcactgattcgacgacccag
cagctgcaatgggaattgaaacaactcggtctggaaagggtcgacgtcttcccgagcgga
gacattacgaacatgccggtgatcaatgagcacaccgtcatcgtcccattgcagccctat
ctgagcgacaccctggccaccctccgccgcgagcggggagccaaggtgttgacgacactc
ctgcccatcggtcctgacggcacggcccgctttttggaagccatctgcgccgagttcggc
cttgacgcctccccagtcgcagaaagggaggcccaaacctggcgcagcttggagagccaa
cgggctctcctgcgcggcaagcggatcatgttcctcggcgataacctgctggagatcccc
ttggcccgctttctcaccgcctgcggcgccgaagtggttgaagccggcacgccctatgtc
cacgccaaggacttatctgaggagatcgccagacttcgggaaaaaggcgtgcctatcgtc
gaaagtcccaatttctccgctcaggtggaacgcatcgaccgtctccgacccgacctgatc
gtggccggcctcggcatctgcaatcccctcgaagcggccggctatacgacggcatggtcg
attgaattcacctttgcccagatccacggcttcgtcaatgccatcgatctgattaaactc
tttgtcaaaccgctcttgaaacggcaggcgctgcttgagcagggctggacggaagcgggg
tggatgtcgtga

DBGET integrated database retrieval system