KEGG   Heliobacterium modesticaldum: HM1_0689Help
Entry
HM1_0689          CDS       T00653                                 

Gene name
bchM
Definition
(GenBank) magnesium protoporphyrin o-methyltransferase
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
hmo  Heliobacterium modesticaldum
Pathway
hmo00860  Porphyrin and chlorophyll metabolism
hmo01100  Metabolic pathways
hmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HM1_0689 (bchM)
Enzymes [BR:hmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     HM1_0689 (bchM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_31 Methyltransf_23 Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_32 Methyltransf_9 MTS NodS TPMT CMAS MetW Ubie_methyltran PCMT PrmA AdoMet_MTase TehB
Motif
Other DBs
NCBI-ProteinID: ABZ83863
UniProt: B0TBM4
Position
1297796..1298479
Genome map
AA seq 227 aa AA seqDB search
MANELNSYWAQQEQVRNYFDGDAFQRWASISKGESKNFAQRKLIEGRQAIHRCLLDWIGP
VAGKRIIDAGCGAGFLAEILAEQGAIVKGIDISTKMIEMASARNGGRDNLTFEVSDLVSE
KGNYDILISMDVLIHYPLADLPALLEHTLGRARERAYITFAPSTAWFRFLKSVGERMSGS
SRTTSAYLHPISEIHSILNTLGYQSTRQKLVSNIIYNAMLLEIKPKR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgaactgaattcctattgggcacaacaggaacaggtgagaaattattttgac
ggcgatgcctttcagcgatgggcgtccatcagcaaaggagaaagcaaaaactttgcccag
cgcaagctcatcgaaggtcgtcaagccatccaccgctgccttttggactggatcgggccg
gtagcgggcaagcgcatcatcgatgccggatgcggcgcaggttttctcgcagagatcctc
gccgaacagggcgctatcgtcaaaggtattgatatttccacgaaaatgatcgaaatggct
tctgcccgcaacggcggaagagacaacctcacctttgaggtcagcgatttagtctcagaa
aaaggaaattatgacatcctcatttcgatggatgtgttgattcattatccccttgcagac
ctgcccgccttgctggaacatacactgggccgcgcccgggaacgggcctatatcaccttc
gcaccgtcgaccgcatggtttcgcttcctcaaatccgtaggcgagcggatgtcgggaagc
tcccgtacaaccagcgcctacctgcatccgatttcggagatccactccattttgaataca
ctgggctaccaatctactcgccaaaagctggtctctaacatcatttataacgcgatgttg
ttagagatcaagccgaaacgatga

DBGET integrated database retrieval system