KEGG   Heliobacterium modesticaldum: HM1_0727Help
Entry
HM1_0727          CDS       T00653                                 

Gene name
prs
Definition
(GenBank) ribose-phosphate pyrophosphokinase
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
hmo  Heliobacterium modesticaldum
Pathway
hmo00030  Pentose phosphate pathway
hmo00230  Purine metabolism
hmo01100  Metabolic pathways
hmo01110  Biosynthesis of secondary metabolites
hmo01120  Microbial metabolism in diverse environments
hmo01130  Biosynthesis of antibiotics
hmo01200  Carbon metabolism
hmo01230  Biosynthesis of amino acids
Module
hmo_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HM1_0727 (prs)
  Nucleotide metabolism
   00230 Purine metabolism
    HM1_0727 (prs)
Enzymes [BR:hmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     HM1_0727 (prs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase tRNA_edit
Motif
Other DBs
NCBI-ProteinID: ABZ83828
UniProt: B0TBA1
Position
1265443..1266390
Genome map
AA seq 315 aa AA seqDB search
MSFFNKKLKIFTGNANPALAEEIAEYLGVQVGAAKVKSFSDGEIQMEIDESVRGADVFVV
QPTCYPVNENIMELLIMVDALRRASARRITAVLPYYGYARQDRKVRARAPISAKLVANIL
TAAGARRVVTMDLHAGQIQGFFDIPVDHLPGVPILAEYFLNKGLQDIVVVSPDLGGVTRA
RDLAERIGASLAIIDKRRPEPNVSEVMNVIGDIEGKTVVITDDIIDTAGTIVNGAKALLE
RGAREVYTCATHGVLSGPAIERIQNSPIKEMILTNTIPLPPEKQIDKIRVLSVAPLLGEA
IIRIHEDLSVSKLFD
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttttcaataaaaagttaaaaatcttcacggggaacgccaacccggcgctggcg
gaagagattgccgagtacctgggggtccaggtgggcgcggcgaaggtcaagagcttcagc
gacggcgagattcagatggagatcgatgagagtgtccgcggcgccgatgtcttcgtcgtc
cagccgacctgctatcctgtcaatgaaaacatcatggaactgctgatcatggtggacgcc
ttgcgccgcgcctcagcgcggcggatcaccgctgttctaccttattatgggtacgcccgg
caggaccggaaggtgcgtgcccgggcgccgatttcggcgaaactggtggccaatatcctg
acggccgccggcgcccgccgcgtcgtcacaatggacctccatgccggccagatccagggc
ttcttcgacatccctgtcgaccacctgcccggtgtgcccatcctggccgagtacttcctc
aacaaggggctccaagacatcgttgtcgtctcgcccgacctgggcggggtgacccgggcg
cgggacctggctgagcggatcggcgcctccctggccatcatcgacaagcgccgccctgag
ccgaacgtctccgaggtcatgaacgtcatcggcgatattgaaggcaagaccgtcgtcatc
accgacgacatcatcgacacggccggtaccatcgtcaacggcgccaaggccctcctggag
cggggcgcccgcgaggtctacacctgcgccacccatggcgtcctgtcgggaccggccatc
gagcggatccagaactcgcccatcaaagagatgatcctgaccaacacgatccccctgccg
ccggaaaagcagatcgataagatccgcgttctctctgtggcgccgctgctcggcgaggcg
atcattcgcatccacgaggacctgtcggtgagcaagttgtttgactga

DBGET integrated database retrieval system